./libgcrypt-1.4.4-i686/0000755000000000000000000000000011237045265013051 5ustar rootroot./libgcrypt-1.4.4-i686/usr/0000755000000000000000000000000011237045210013650 5ustar rootroot./libgcrypt-1.4.4-i686/usr/local/0000755000000000000000000000000011237045211014743 5ustar rootroot./libgcrypt-1.4.4-i686/usr/local/share/0000755000000000000000000000000011237045211016045 5ustar rootroot./libgcrypt-1.4.4-i686/usr/local/share/info/0000755000000000000000000000000011237045211017000 5ustar rootroot./libgcrypt-1.4.4-i686/usr/local/share/info/gcrypt.info0000644000000000000000000110034711237045207021200 0ustar rootrootThis is gcrypt.info, produced by makeinfo version 4.11 from gcrypt.texi. This manual is for Libgcrypt (version 1.4.4, 22 January 2009), which is GNU's library of cryptographic building blocks. Copyright (C) 2000, 2002, 2003, 2004, 2006, 2007, 2008 Free Software Foundation, Inc. Permission is granted to copy, distribute and/or modify this document under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. The text of the license can be found in the section entitled "GNU General Public License". INFO-DIR-SECTION GNU Libraries START-INFO-DIR-ENTRY * libgcrypt: (gcrypt). Cryptographic function library. END-INFO-DIR-ENTRY  File: gcrypt.info, Node: Top, Next: Introduction, Up: (dir) The Libgcrypt Library ********************* This manual is for Libgcrypt (version 1.4.4, 22 January 2009), which is GNU's library of cryptographic building blocks. Copyright (C) 2000, 2002, 2003, 2004, 2006, 2007, 2008 Free Software Foundation, Inc. Permission is granted to copy, distribute and/or modify this document under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. The text of the license can be found in the section entitled "GNU General Public License". * Menu: * Introduction:: What is Libgcrypt. * Preparation:: What you should do before using the library. * Generalities:: General library functions and data types. * Handler Functions:: Working with handler functions. * Symmetric cryptography:: How to use symmetric cryptography. * Public Key cryptography:: How to use public key cryptography. * Hashing:: How to use hash and MAC algorithms. * Random Numbers:: How to work with random numbers. * S-expressions:: How to manage S-expressions. * MPI library:: How to work with multi-precision-integers. * Prime numbers:: How to use the Prime number related functions. * Utilities:: Utility functions. * Architecture:: How Libgcrypt works internally. Appendices * Self-Tests:: Description of the self-tests. * FIPS Mode:: Description of the FIPS mode. * Library Copying:: The GNU Lesser General Public License says how you can copy and share Libgcrypt. * Copying:: The GNU General Public License says how you can copy and share some parts of Libgcrypt. Indices * Figures and Tables:: Index of figures and tables. * Concept Index:: Index of concepts and programs. * Function and Data Index:: Index of functions, variables and data types.  File: gcrypt.info, Node: Introduction, Next: Preparation, Prev: Top, Up: Top 1 Introduction ************** Libgcrypt is a library providing cryptographic building blocks. * Menu: * Getting Started:: How to use this manual. * Features:: A glance at Libgcrypt's features. * Overview:: Overview about the library.  File: gcrypt.info, Node: Getting Started, Next: Features, Up: Introduction 1.1 Getting Started =================== This manual documents the Libgcrypt library application programming interface (API). All functions and data types provided by the library are explained. The reader is assumed to possess basic knowledge about applied cryptography. This manual can be used in several ways. If read from the beginning to the end, it gives a good introduction into the library and how it can be used in an application. Forward references are included where necessary. Later on, the manual can be used as a reference manual to get just the information needed about any particular interface of the library. Experienced programmers might want to start looking at the examples at the end of the manual, and then only read up those parts of the interface which are unclear.  File: gcrypt.info, Node: Features, Next: Overview, Prev: Getting Started, Up: Introduction 1.2 Features ============ Libgcrypt might have a couple of advantages over other libraries doing a similar job. It's Free Software Anybody can use, modify, and redistribute it under the terms of the GNU Lesser General Public License (*note Library Copying::). Note, that some parts (which are in general not needed by applications) are subject to the terms of the GNU General Public License (*note Copying::); please see the README file of the distribution for of list of these parts. It encapsulates the low level cryptography Libgcrypt provides a high level interface to cryptographic building blocks using an extensible and flexible API.  File: gcrypt.info, Node: Overview, Prev: Features, Up: Introduction 1.3 Overview ============ The Libgcrypt library is fully thread-safe, where it makes sense to be thread-safe. Not thread-safe are some cryptographic functions that modify a certain context stored in handles. If the user really intents to use such functions from different threads on the same handle, he has to take care of the serialization of such functions himself. If not described otherwise, every function is thread-safe. Libgcrypt depends on the library `libgpg-error', which contains common error handling related code for GnuPG components.  File: gcrypt.info, Node: Preparation, Next: Generalities, Prev: Introduction, Up: Top 2 Preparation ************* To use Libgcrypt, you have to perform some changes to your sources and the build system. The necessary changes are small and explained in the following sections. At the end of this chapter, it is described how the library is initialized, and how the requirements of the library are verified. * Menu: * Header:: What header file you need to include. * Building sources:: How to build sources using the library. * Building sources using Automake:: How to build sources with the help of Automake. * Initializing the library:: How to initialize the library. * Multi-Threading:: How Libgcrypt can be used in a MT environment. * Enabling FIPS mode:: How to enable the FIPS mode.  File: gcrypt.info, Node: Header, Next: Building sources, Up: Preparation 2.1 Header ========== All interfaces (data types and functions) of the library are defined in the header file `gcrypt.h'. You must include this in all source files using the library, either directly or through some other header file, like this: #include The name space of Libgcrypt is `gcry_*' for function and type names and `GCRY*' for other symbols. In addition the same name prefixes with one prepended underscore are reserved for internal use and should never be used by an application. Note that Libgcrypt uses libgpg-error, which uses `gpg_*' as name space for function and type names and `GPG_*' for other symbols, including all the error codes. Certain parts of gcrypt.h may be excluded by defining these macros: `GCRYPT_NO_MPI_MACROS' Do not define the shorthand macros `mpi_*' for `gcry_mpi_*'. `GCRYPT_NO_DEPRECATED' Do not include defintions for deprecated features. This is useful to make sure that no deprecated features are used.  File: gcrypt.info, Node: Building sources, Next: Building sources using Automake, Prev: Header, Up: Preparation 2.2 Building sources ==================== If you want to compile a source file including the `gcrypt.h' header file, you must make sure that the compiler can find it in the directory hierarchy. This is accomplished by adding the path to the directory in which the header file is located to the compilers include file search path (via the `-I' option). However, the path to the include file is determined at the time the source is configured. To solve this problem, Libgcrypt ships with a small helper program `libgcrypt-config' that knows the path to the include file and other configuration options. The options that need to be added to the compiler invocation at compile time are output by the `--cflags' option to `libgcrypt-config'. The following example shows how it can be used at the command line: gcc -c foo.c `libgcrypt-config --cflags` Adding the output of `libgcrypt-config --cflags' to the compilers command line will ensure that the compiler can find the Libgcrypt header file. A similar problem occurs when linking the program with the library. Again, the compiler has to find the library files. For this to work, the path to the library files has to be added to the library search path (via the `-L' option). For this, the option `--libs' to `libgcrypt-config' can be used. For convenience, this option also outputs all other options that are required to link the program with the Libgcrypt libraries (in particular, the `-lgcrypt' option). The example shows how to link `foo.o' with the Libgcrypt library to a program `foo'. gcc -o foo foo.o `libgcrypt-config --libs` Of course you can also combine both examples to a single command by specifying both options to `libgcrypt-config': gcc -o foo foo.c `libgcrypt-config --cflags --libs`  File: gcrypt.info, Node: Building sources using Automake, Next: Initializing the library, Prev: Building sources, Up: Preparation 2.3 Building sources using Automake =================================== It is much easier if you use GNU Automake instead of writing your own Makefiles. If you do that, you do not have to worry about finding and invoking the `libgcrypt-config' script at all. Libgcrypt provides an extension to Automake that does all the work for you. -- Macro: AM_PATH_LIBGCRYPT ([MINIMUM-VERSION], [ACTION-IF-FOUND], [ACTION-IF-NOT-FOUND]) Check whether Libgcrypt (at least version MINIMUM-VERSION, if given) exists on the host system. If it is found, execute ACTION-IF-FOUND, otherwise do ACTION-IF-NOT-FOUND, if given. Additionally, the function defines `LIBGCRYPT_CFLAGS' to the flags needed for compilation of the program to find the `gcrypt.h' header file, and `LIBGCRYPT_LIBS' to the linker flags needed to link the program to the Libgcrypt library. You can use the defined Autoconf variables like this in your `Makefile.am': AM_CPPFLAGS = $(LIBGCRYPT_CFLAGS) LDADD = $(LIBGCRYPT_LIBS)  File: gcrypt.info, Node: Initializing the library, Next: Multi-Threading, Prev: Building sources using Automake, Up: Preparation 2.4 Initializing the library ============================ Before the library can be used, it must initialize itself. This is achieved by invoking the function `gcry_check_version' described below. Also, it is often desirable to check that the version of Libgcrypt used is indeed one which fits all requirements. Even with binary compatibility, new features may have been introduced, but due to problem with the dynamic linker an old version may actually be used. So you may want to check that the version is okay right after program startup. -- Function: const char * gcry_check_version (const char *REQ_VERSION) The function `gcry_check_version' initializes some subsystems used by Libgcrypt and must be invoked before any other function in the library, with the exception of the `GCRYCTL_SET_THREAD_CBS' command (called via the `gcry_control' function). *Note Multi-Threading::. Furthermore, this function returns the version number of the library. It can also verify that the version number is higher than a certain required version number REQ_VERSION, if this value is not a null pointer. Libgcrypt uses a concept known as secure memory, which is a region of memory set aside for storing sensitive data. Because such memory is a scarce resource, it needs to be setup in advanced to a fixed size. Further, most operating systems have special requirements on how that secure memory can be used. For example, it might be required to install an application as "setuid(root)" to allow allocating such memory. Libgcrypt requires a sequence of initialization steps to make sure that this works correctly. The following examples show the necessary steps. If you don't have a need for secure memory, for example if your application does not use secret keys or other confidential data or it runs in a controlled environment where key material floating around in memory is not a problem, you should initialize Libgcrypt this way: /* Version check should be the very first call because it makes sure that important subsystems are intialized. */ if (!gcry_check_version (GCRYPT_VERSION)) { fputs ("libgcrypt version mismatch\n", stderr); exit (2); } /* Disable secure memory. */ gcry_control (GCRYCTL_DISABLE_SECMEM, 0); /* ... If required, other initialization goes here. */ /* Tell Libgcrypt that initialization has completed. */ gcry_control (GCRYCTL_INITIALIZATION_FINISHED, 0); If you have to protect your keys or other information in memory against being swapped out to disk and to enable an automatic overwrite of used and freed memory, you need to initialize Libgcrypt this way: /* Version check should be the very first call because it makes sure that important subsystems are intialized. */ if (!gcry_check_version (GCRYPT_VERSION)) { fputs ("libgcrypt version mismatch\n", stderr); exit (2); } /* We don't want to see any warnings, e.g. because we have not yet parsed program options which might be used to suppress such warnings. */ gcry_control (GCRYCTL_SUSPEND_SECMEM_WARN); /* ... If required, other initialization goes here. Note that the process might still be running with increased privileges and that the secure memory has not been intialized. */ /* Allocate a pool of 16k secure memory. This make the secure memory available and also drops privileges where needed. */ gcry_control (GCRYCTL_INIT_SECMEM, 16384, 0); /* It is now okay to let Libgcrypt complain when there was/is a problem with the secure memory. */ gcry_control (GCRYCTL_RESUME_SECMEM_WARN); /* ... If required, other initialization goes here. */ /* Tell Libgcrypt that initialization has completed. */ gcry_control (GCRYCTL_INITIALIZATION_FINISHED, 0); It is important that these initialization steps are not done by a library but by the actual application. A library using Libgcrypt might want to check for finished initialization using: if (!gcry_control (GCRYCTL_INITIALIZATION_FINISHED_P)) { fputs ("libgcrypt has not been initialized\n", stderr); abort (); } Instead of terminating the process, the library may instead print a warning and try to initialize Libgcrypt itself. See also the section on multi-threading below for more pitfalls.  File: gcrypt.info, Node: Multi-Threading, Next: Enabling FIPS mode, Prev: Initializing the library, Up: Preparation 2.5 Multi-Threading =================== As mentioned earlier, the Libgcrypt library is thread-safe if you adhere to the following requirements: * If your application is multi-threaded, you must set the thread support callbacks with the `GCRYCTL_SET_THREAD_CBS' command *before* any other function in the library. This is easy enough if you are indeed writing an application using Libgcrypt. It is rather problematic if you are writing a library instead. Here are some tips what to do if you are writing a library: If your library requires a certain thread package, just initialize Libgcrypt to use this thread package. If your library supports multiple thread packages, but needs to be configured, you will have to implement a way to determine which thread package the application wants to use with your library anyway. Then configure Libgcrypt to use this thread package. If your library is fully reentrant without any special support by a thread package, then you are lucky indeed. Unfortunately, this does not relieve you from doing either of the two above, or use a third option. The third option is to let the application initialize Libgcrypt for you. Then you are not using Libgcrypt transparently, though. As if this was not difficult enough, a conflict may arise if two libraries try to initialize Libgcrypt independently of each others, and both such libraries are then linked into the same application. To make it a bit simpler for you, this will probably work, but only if both libraries have the same requirement for the thread package. This is currently only supported for the non-threaded case, GNU Pth and pthread. Support for more thread packages is easy to add, so contact us if you require it. * The function `gcry_check_version' must be called before any other function in the library, except the `GCRYCTL_SET_THREAD_CBS' command (called via the `gcry_control' function), because it initializes the thread support subsystem in Libgcrypt. To achieve this in multi-threaded programs, you must synchronize the memory with respect to other threads that also want to use Libgcrypt. For this, it is sufficient to call `gcry_check_version' before creating the other threads using Libgcrypt(1). * Just like the function `gpg_strerror', the function `gcry_strerror' is not thread safe. You have to use `gpg_strerror_r' instead. Libgcrypt contains convenient macros, which define the necessary thread callbacks for PThread and for GNU Pth: `GCRY_THREAD_OPTION_PTH_IMPL' This macro defines the following (static) symbols: `gcry_pth_init', `gcry_pth_mutex_init', `gcry_pth_mutex_destroy', `gcry_pth_mutex_lock', `gcry_pth_mutex_unlock', `gcry_pth_read', `gcry_pth_write', `gcry_pth_select', `gcry_pth_waitpid', `gcry_pth_accept', `gcry_pth_connect', `gcry_threads_pth'. After including this macro, `gcry_control()' shall be used with a command of `GCRYCTL_SET_THREAD_CBS' in order to register the thread callback structure named "gcry_threads_pth". `GCRY_THREAD_OPTION_PTHREAD_IMPL' This macro defines the following (static) symbols: `gcry_pthread_mutex_init', `gcry_pthread_mutex_destroy', `gcry_pthread_mutex_lock', `gcry_pthread_mutex_unlock', `gcry_threads_pthread'. After including this macro, `gcry_control()' shall be used with a command of `GCRYCTL_SET_THREAD_CBS' in order to register the thread callback structure named "gcry_threads_pthread". Note that these macros need to be terminated with a semicolon. Keep in mind that these are convenient macros for C programmers; C++ programmers might have to wrap these macros in an "extern C" body. ---------- Footnotes ---------- (1) At least this is true for POSIX threads, as `pthread_create' is a function that synchronizes memory with respects to other threads. There are many functions which have this property, a complete list can be found in POSIX, IEEE Std 1003.1-2003, Base Definitions, Issue 6, in the definition of the term "Memory Synchronization". For other thread packages, more relaxed or more strict rules may apply.  File: gcrypt.info, Node: Enabling FIPS mode, Prev: Multi-Threading, Up: Preparation 2.6 How to enable the FIPS mode =============================== Libgcrypt may be used in a FIPS 140-2 mode. Note, that this does not necessary mean that Libcgrypt is an appoved FIPS 140-2 module. Check the NIST database at `http://csrc.nist.gov/groups/STM/cmvp/' to see what versions of Libgcrypt are approved. Because FIPS 140 has certain restrictions on the use of cryptography which are not always wanted, Libgcrypt needs to be put into FIPS mode explicitly. Three alternative mechanisms are provided to switch Libgcrypt into this mode: * If the file `/proc/sys/crypto/fips_enabled' exists and contains a numeric value other than `0', Libgcrypt is put into FIPS mode at initialization time. Obviously this works only on systems with a `proc' file system (i.e. GNU/Linux). * If the file `/etc/gcrypt/fips_enabled' exists, Libgcrypt is put into FIPS mode at initialization time. Note that this filename is hardwired and does not depend on any configuration options. * If the application requests FIPS mode using the control command `GCRYCTL_FORCE_FIPS_MODE'. This must be done prior to any initialization (i.e. before `gcry_check_version'). In addition to the standard FIPS mode, Libgcrypt may also be put into an Enforced FIPS mode by writing a non-zero value into the file `/etc/gcrypt/fips_enabled'. The Enforced FIPS mode helps to detect applications which don't fulfill all requirements for using Libgcrypt in FIPS mode (*note FIPS Mode::). Once Libgcrypt has been put into FIPS mode, it is not possible to switch back to standard mode without terminating the process first. If the logging verbosity level of Libgcrypt has been set to at least 2, the state transitions and the self-tests are logged.  File: gcrypt.info, Node: Generalities, Next: Handler Functions, Prev: Preparation, Up: Top 3 Generalities ************** * Menu: * Controlling the library:: Controlling Libgcrypt's behavior. * Modules:: Description of extension modules. * Error Handling:: Error codes and such.  File: gcrypt.info, Node: Controlling the library, Next: Modules, Up: Generalities 3.1 Controlling the library =========================== -- Function: gcry_error_t gcry_control (enum gcry_ctl_cmds CMD, ...) This function can be used to influence the general behavior of Libgcrypt in several ways. Depending on CMD, more arguments can or have to be provided. `GCRYCTL_ENABLE_M_GUARD; Arguments: none' This command enables the built-in memory guard. It must not be used to activate the memory guard after the memory management has already been used; therefore it can ONLY be used at initialization time. Note that the memory guard is NOT used when the user of the library has set his own memory management callbacks. `GCRYCTL_ENABLE_QUICK_RANDOM; Arguments: none' This command inhibits the use the very secure random quality level (`GCRY_VERY_STRONG_RANDOM') and degrades all request down to `GCRY_STRONG_RANDOM'. In general this is not recommened. However, for some applications the extra quality random Libgcrypt tries to create is not justified and this option may help to get better performace. Please check with a crypto expert whether this option can be used for your application. This option can only be used at initialization time. `GCRYCTL_DUMP_RANDOM_STATS; Arguments: none' This command dumps randum number generator related statistics to the library's logging stream. `GCRYCTL_DUMP_MEMORY_STATS; Arguments: none' This command dumps memory managment related statistics to the library's logging stream. `GCRYCTL_DUMP_SECMEM_STATS; Arguments: none' This command dumps secure memory manamgent related statistics to the library's logging stream. `GCRYCTL_DROP_PRIVS; Arguments: none' This command disables the use of secure memory and drops the priviliges of the current process. This command has not much use; the suggested way to disable secure memory is to use `GCRYCTL_DISABLE_SECMEM' right after initialization. `GCRYCTL_DISABLE_SECMEM; Arguments: none' This command disables the use of secure memory. If this command is used in FIPS mode, FIPS mode will be disabled and the function `gcry_fips_mode_active' returns false. However, in Enforced FIPS mode this command has no effect at all. Many applications do not require secure memory, so they should disable it right away. This command should be executed right after `gcry_check_version'. `GCRYCTL_INIT_SECMEM; Arguments: int nbytes' This command is used to allocate a pool of secure memory and thus enabling the use of secure memory. It also drops all extra privileges the process has (i.e. if it is run as setuid (root)). If the argument NBYTES is 0, secure memory will be disabled. The minimum amount of secure memory allocated is currently 16384 bytes; you may thus use a value of 1 to request that default size. `GCRYCTL_TERM_SECMEM; Arguments: none' This command zeroises the secure memory and destroys the handler. The secure memory pool may not be used anymore after running this command. If the secure memory pool as already been destroyed, this command has no effect. Applications might want to run this command from their exit handler to make sure that the secure memory gets properly destroyed. This command is not necessarily thread-safe but that should not be needed in cleanup code. It may be called from a signal handler. `GCRYCTL_DISABLE_SECMEM_WARN; Arguments: none' Disable warning messages about problems with the secure memory subsystem. This command should be run right after `gcry_check_version'. `GCRYCTL_SUSPEND_SECMEM_WARN; Arguments: none' Postpone warning messages from the secure memory subsystem. *Note the initialization example: sample-use-suspend-secmem, on how to use it. `GCRYCTL_RESUME_SECMEM_WARN; Arguments: none' Resume warning messages from the secure memory subsystem. *Note the initialization example: sample-use-resume-secmem, on how to use it. `GCRYCTL_USE_SECURE_RNDPOOL; Arguments: none' This command tells the PRNG to store random numbers in secure memory. This command should be run right after `gcry_check_version' and not later than the command GCRYCTL_INIT_SECMEM. Note that in FIPS mode the secure memory is always used. `GCRYCTL_SET_RANDOM_SEED_FILE; Arguments: const char *filename' This command specifies the file, which is to be used as seed file for the PRNG. If the seed file is registered prior to initialization of the PRNG, the seed file's content (if it exists and seems to be valid) is fed into the PRNG pool. After the seed file has been registered, the PRNG can be signalled to write out the PRNG pool's content into the seed file with the following command. `GCRYCTL_UPDATE_RANDOM_SEED_FILE; Arguments: none' Write out the PRNG pool's content into the registered seed file. Multiple instances of the applications sharing the same random seed file can be started in parallel, in which case they will read out the same pool and then race for updating it (the last update overwrites earlier updates). They will differentiate only by the weak entropy that is added in read_seed_file based on the PID and clock, and up to 16 bytes of weak random non-blockingly. The consequence is that the output of these different instances is correlated to some extent. In a perfect attack scenario, the attacker can control (or at least guess) the PID and clock of the application, and drain the system's entropy pool to reduce the "up to 16 bytes" above to 0. Then the dependencies of the inital states of the pools are completely known. Note that this is not an issue if random of `GCRY_VERY_STRONG_RANDOM' quality is requested as in this case enough extra entropy gets mixed. It is also not an issue when using Linux (rndlinux driver), because this one guarantees to read full 16 bytes from /dev/urandom and thus there is no way for an attacker without kernel access to control these 16 bytes. `GCRYCTL_SET_VERBOSITY; Arguments: int level' This command sets the verbosity of the logging. A level of 0 disables all extra logging whereas positive numbers enable more verbose logging. The level may be changed at any time but be aware that no memory synchronization is done so the effect of this command might not immediately show up in other threads. This command may even be used prior to `gcry_check_version'. `GCRYCTL_SET_DEBUG_FLAGS; Arguments: unsigned int flags' Set the debug flag bits as given by the argument. Be aware that that no memory synchronization is done so the effect of this command might not immediately show up in other threads. The debug flags are not considered part of the API and thus may change without notice. As of now bit 0 enables debugging of cipher functions and bit 1 debugging of multi-precision-integers. This command may even be used prior to `gcry_check_version'. `GCRYCTL_CLEAR_DEBUG_FLAGS; Arguments: unsigned int flags' Set the debug flag bits as given by the argument. Be aware that that no memory synchronization is done so the effect of this command might not immediately show up in other threads. This command may even be used prior to `gcry_check_version'. `GCRYCTL_DISABLE_INTERNAL_LOCKING; Arguments: none' This command does nothing. It exists only for backward compatibility. `GCRYCTL_ANY_INITIALIZATION_P; Arguments: none' This command returns true if the library has been basically initialized. Such a basic initialization happens implicitly with many commands to get certain internal subsystems running. The common and suggested way to do this basic intialization is by calling gcry_check_version. `GCRYCTL_INITIALIZATION_FINISHED; Arguments: none' This command tells the libray that the application has finished the intialization. `GCRYCTL_INITIALIZATION_FINISHED_P; Arguments: none' This command returns true if the command GCRYCTL_INITIALIZATION_FINISHED has already been run. `GCRYCTL_SET_THREAD_CBS; Arguments: struct ath_ops *ath_ops' This command registers a thread-callback structure. *Note Multi-Threading::. `GCRYCTL_FAST_POLL; Arguments: none' Run a fast random poll. `GCRYCTL_SET_RNDEGD_SOCKET; Arguments: const char *filename' This command may be used to override the default name of the EGD socket to connect to. It may be used only during initialization as it is not thread safe. Changing the socket name again is not supported. The function may return an error if the given filename is too long for a local socket name. EGD is an alternative random gatherer, used only on systems lacking a proper random device. `GCRYCTL_PRINT_CONFIG; Arguments: FILE *stream' This command dumps information pertaining to the configuration of the library to the given stream. If NULL is given for STREAM, the log system is used. This command may be used before the intialization has been finished but not before a gcry_version_check. `GCRYCTL_OPERATIONAL_P; Arguments: none' This command returns true if the library is in an operational state. This information makes only sense in FIPS mode. In contrast to other functions, this is a pure test function and won't put the library into FIPS mode or change the internal state. This command may be used before the intialization has been finished but not before a gcry_version_check. `GCRYCTL_FIPS_MODE_P; Arguments: none' This command returns true if the library is in FIPS mode. Note, that this is no indication about the current state of the library. This command may be used before the intialization has been finished but not before a gcry_version_check. An application may use this command or the convenience macro below to check whether FIPS mode is actually active. -- Function: int gcry_fips_mode_active (void) Returns true if the FIPS mode is active. Note that this is implemented as a macro. `GCRYCTL_FORCE_FIPS_MODE; Arguments: none' Running this command puts the library into FIPS mode. If the library is already in FIPS mode, a self-test is triggered and thus the library will be put into operational state. This command may be used before a call to gcry_check_version and that is actually the recommended way to let an application switch the library into FIPS mode. Note that Libgcrypt will reject an attempt to switch to fips mode during or after the intialization. `GCRYCTL_SELFTEST; Arguments: none' This may be used at anytime to have the library run all implemented self-tests. It works in standard and in FIPS mode. Returns 0 on success or an error code on failure.  File: gcrypt.info, Node: Modules, Next: Error Handling, Prev: Controlling the library, Up: Generalities 3.2 Modules =========== Libgcrypt supports the use of `extension modules', which implement algorithms in addition to those already built into the library directly. -- Data type: gcry_module_t This data type represents a `module'. Functions registering modules provided by the user take a `module specification structure' as input and return a value of `gcry_module_t' and an ID that is unique in the modules' category. This ID can be used to reference the newly registered module. After registering a module successfully, the new functionality should be able to be used through the normal functions provided by Libgcrypt until it is unregistered again.  File: gcrypt.info, Node: Error Handling, Prev: Modules, Up: Generalities 3.3 Error Handling ================== Many functions in Libgcrypt can return an error if they fail. For this reason, the application should always catch the error condition and take appropriate measures, for example by releasing the resources and passing the error up to the caller, or by displaying a descriptive message to the user and cancelling the operation. Some error values do not indicate a system error or an error in the operation, but the result of an operation that failed properly. For example, if you try to decrypt a tempered message, the decryption will fail. Another error value actually means that the end of a data buffer or list has been reached. The following descriptions explain for many error codes what they mean usually. Some error values have specific meanings if returned by a certain functions. Such cases are described in the documentation of those functions. Libgcrypt uses the `libgpg-error' library. This allows to share the error codes with other components of the GnuPG system, and to pass error values transparently from the crypto engine, or some helper application of the crypto engine, to the user. This way no information is lost. As a consequence, Libgcrypt does not use its own identifiers for error codes, but uses those provided by `libgpg-error'. They usually start with `GPG_ERR_'. However, Libgcrypt does provide aliases for the functions defined in libgpg-error, which might be preferred for name space consistency. Most functions in Libgcrypt return an error code in the case of failure. For this reason, the application should always catch the error condition and take appropriate measures, for example by releasing the resources and passing the error up to the caller, or by displaying a descriptive message to the user and canceling the operation. Some error values do not indicate a system error or an error in the operation, but the result of an operation that failed properly. GnuPG components, including Libgcrypt, use an extra library named libgpg-error to provide a common error handling scheme. For more information on libgpg-error, see the according manual. * Menu: * Error Values:: The error value and what it means. * Error Sources:: A list of important error sources. * Error Codes:: A list of important error codes. * Error Strings:: How to get a descriptive string from a value.  File: gcrypt.info, Node: Error Values, Next: Error Sources, Up: Error Handling 3.3.1 Error Values ------------------ -- Data type: gcry_err_code_t The `gcry_err_code_t' type is an alias for the `libgpg-error' type `gpg_err_code_t'. The error code indicates the type of an error, or the reason why an operation failed. A list of important error codes can be found in the next section. -- Data type: gcry_err_source_t The `gcry_err_source_t' type is an alias for the `libgpg-error' type `gpg_err_source_t'. The error source has not a precisely defined meaning. Sometimes it is the place where the error happened, sometimes it is the place where an error was encoded into an error value. Usually the error source will give an indication to where to look for the problem. This is not always true, but it is attempted to achieve this goal. A list of important error sources can be found in the next section. -- Data type: gcry_error_t The `gcry_error_t' type is an alias for the `libgpg-error' type `gpg_error_t'. An error value like this has always two components, an error code and an error source. Both together form the error value. Thus, the error value can not be directly compared against an error code, but the accessor functions described below must be used. However, it is guaranteed that only 0 is used to indicate success (`GPG_ERR_NO_ERROR'), and that in this case all other parts of the error value are set to 0, too. Note that in Libgcrypt, the error source is used purely for diagnostic purposes. Only the error code should be checked to test for a certain outcome of a function. The manual only documents the error code part of an error value. The error source is left unspecified and might be anything. -- Function: gcry_err_code_t gcry_err_code (gcry_error_t ERR) The static inline function `gcry_err_code' returns the `gcry_err_code_t' component of the error value ERR. This function must be used to extract the error code from an error value in order to compare it with the `GPG_ERR_*' error code macros. -- Function: gcry_err_source_t gcry_err_source (gcry_error_t ERR) The static inline function `gcry_err_source' returns the `gcry_err_source_t' component of the error value ERR. This function must be used to extract the error source from an error value in order to compare it with the `GPG_ERR_SOURCE_*' error source macros. -- Function: gcry_error_t gcry_err_make (gcry_err_source_t SOURCE, gcry_err_code_t CODE) The static inline function `gcry_err_make' returns the error value consisting of the error source SOURCE and the error code CODE. This function can be used in callback functions to construct an error value to return it to the library. -- Function: gcry_error_t gcry_error (gcry_err_code_t CODE) The static inline function `gcry_error' returns the error value consisting of the default error source and the error code CODE. For GCRY applications, the default error source is `GPG_ERR_SOURCE_USER_1'. You can define `GCRY_ERR_SOURCE_DEFAULT' before including `gcrypt.h' to change this default. This function can be used in callback functions to construct an error value to return it to the library. The `libgpg-error' library provides error codes for all system error numbers it knows about. If ERR is an unknown error number, the error code `GPG_ERR_UNKNOWN_ERRNO' is used. The following functions can be used to construct error values from system errno numbers. -- Function: gcry_error_t gcry_err_make_from_errno (gcry_err_source_t SOURCE, int ERR) The function `gcry_err_make_from_errno' is like `gcry_err_make', but it takes a system error like `errno' instead of a `gcry_err_code_t' error code. -- Function: gcry_error_t gcry_error_from_errno (int ERR) The function `gcry_error_from_errno' is like `gcry_error', but it takes a system error like `errno' instead of a `gcry_err_code_t' error code. Sometimes you might want to map system error numbers to error codes directly, or map an error code representing a system error back to the system error number. The following functions can be used to do that. -- Function: gcry_err_code_t gcry_err_code_from_errno (int ERR) The function `gcry_err_code_from_errno' returns the error code for the system error ERR. If ERR is not a known system error, the function returns `GPG_ERR_UNKNOWN_ERRNO'. -- Function: int gcry_err_code_to_errno (gcry_err_code_t ERR) The function `gcry_err_code_to_errno' returns the system error for the error code ERR. If ERR is not an error code representing a system error, or if this system error is not defined on this system, the function returns `0'.  File: gcrypt.info, Node: Error Sources, Next: Error Codes, Prev: Error Values, Up: Error Handling 3.3.2 Error Sources ------------------- The library `libgpg-error' defines an error source for every component of the GnuPG system. The error source part of an error value is not well defined. As such it is mainly useful to improve the diagnostic error message for the user. If the error code part of an error value is `0', the whole error value will be `0'. In this case the error source part is of course `GPG_ERR_SOURCE_UNKNOWN'. The list of error sources that might occur in applications using Libgcrypt is: `GPG_ERR_SOURCE_UNKNOWN' The error source is not known. The value of this error source is `0'. `GPG_ERR_SOURCE_GPGME' The error source is GPGME itself. `GPG_ERR_SOURCE_GPG' The error source is GnuPG, which is the crypto engine used for the OpenPGP protocol. `GPG_ERR_SOURCE_GPGSM' The error source is GPGSM, which is the crypto engine used for the OpenPGP protocol. `GPG_ERR_SOURCE_GCRYPT' The error source is `libgcrypt', which is used by crypto engines to perform cryptographic operations. `GPG_ERR_SOURCE_GPGAGENT' The error source is `gpg-agent', which is used by crypto engines to perform operations with the secret key. `GPG_ERR_SOURCE_PINENTRY' The error source is `pinentry', which is used by `gpg-agent' to query the passphrase to unlock a secret key. `GPG_ERR_SOURCE_SCD' The error source is the SmartCard Daemon, which is used by `gpg-agent' to delegate operations with the secret key to a SmartCard. `GPG_ERR_SOURCE_KEYBOX' The error source is `libkbx', a library used by the crypto engines to manage local keyrings. `GPG_ERR_SOURCE_USER_1' `GPG_ERR_SOURCE_USER_2' `GPG_ERR_SOURCE_USER_3' `GPG_ERR_SOURCE_USER_4' These error sources are not used by any GnuPG component and can be used by other software. For example, applications using Libgcrypt can use them to mark error values coming from callback handlers. Thus `GPG_ERR_SOURCE_USER_1' is the default for errors created with `gcry_error' and `gcry_error_from_errno', unless you define `GCRY_ERR_SOURCE_DEFAULT' before including `gcrypt.h'.  File: gcrypt.info, Node: Error Codes, Next: Error Strings, Prev: Error Sources, Up: Error Handling 3.3.3 Error Codes ----------------- The library `libgpg-error' defines many error values. The following list includes the most important error codes. `GPG_ERR_EOF' This value indicates the end of a list, buffer or file. `GPG_ERR_NO_ERROR' This value indicates success. The value of this error code is `0'. Also, it is guaranteed that an error value made from the error code `0' will be `0' itself (as a whole). This means that the error source information is lost for this error code, however, as this error code indicates that no error occurred, this is generally not a problem. `GPG_ERR_GENERAL' This value means that something went wrong, but either there is not enough information about the problem to return a more useful error value, or there is no separate error value for this type of problem. `GPG_ERR_ENOMEM' This value means that an out-of-memory condition occurred. `GPG_ERR_E...' System errors are mapped to GPG_ERR_EFOO where FOO is the symbol for the system error. `GPG_ERR_INV_VALUE' This value means that some user provided data was out of range. `GPG_ERR_UNUSABLE_PUBKEY' This value means that some recipients for a message were invalid. `GPG_ERR_UNUSABLE_SECKEY' This value means that some signers were invalid. `GPG_ERR_NO_DATA' This value means that data was expected where no data was found. `GPG_ERR_CONFLICT' This value means that a conflict of some sort occurred. `GPG_ERR_NOT_IMPLEMENTED' This value indicates that the specific function (or operation) is not implemented. This error should never happen. It can only occur if you use certain values or configuration options which do not work, but for which we think that they should work at some later time. `GPG_ERR_DECRYPT_FAILED' This value indicates that a decryption operation was unsuccessful. `GPG_ERR_WRONG_KEY_USAGE' This value indicates that a key is not used appropriately. `GPG_ERR_NO_SECKEY' This value indicates that no secret key for the user ID is available. `GPG_ERR_UNSUPPORTED_ALGORITHM' This value means a verification failed because the cryptographic algorithm is not supported by the crypto backend. `GPG_ERR_BAD_SIGNATURE' This value means a verification failed because the signature is bad. `GPG_ERR_NO_PUBKEY' This value means a verification failed because the public key is not available. `GPG_ERR_NOT_OPERATIONAL' This value means that the library is not yet in state which allows to use this function. This error code is in particular returned if Libgcrypt is operated in FIPS mode and the internal state of the library does not yet or not anymore allow the use of a service. This error code is only available with newer libgpg-error versions, thus you might see "invalid error code" when passing this to `gpg_strerror'. The numeric value of this error code is 176. `GPG_ERR_USER_1' `GPG_ERR_USER_2' `...' `GPG_ERR_USER_16' These error codes are not used by any GnuPG component and can be freely used by other software. Applications using Libgcrypt might use them to mark specific errors returned by callback handlers if no suitable error codes (including the system errors) for these errors exist already.  File: gcrypt.info, Node: Error Strings, Prev: Error Codes, Up: Error Handling 3.3.4 Error Strings ------------------- -- Function: const char * gcry_strerror (gcry_error_t ERR) The function `gcry_strerror' returns a pointer to a statically allocated string containing a description of the error code contained in the error value ERR. This string can be used to output a diagnostic message to the user. -- Function: const char * gcry_strsource (gcry_error_t ERR) The function `gcry_strerror' returns a pointer to a statically allocated string containing a description of the error source contained in the error value ERR. This string can be used to output a diagnostic message to the user. The following example illustrates the use of the functions described above: { gcry_cipher_hd_t handle; gcry_error_t err = 0; err = gcry_cipher_open (&handle, GCRY_CIPHER_AES, GCRY_CIPHER_MODE_CBC, 0); if (err) { fprintf (stderr, "Failure: %s/%s\n", gcry_strsource (err), gcry_strerror (err)); } }  File: gcrypt.info, Node: Handler Functions, Next: Symmetric cryptography, Prev: Generalities, Up: Top 4 Handler Functions ******************* Libgcrypt makes it possible to install so called `handler functions', which get called by Libgcrypt in case of certain events. * Menu: * Progress handler:: Using a progress handler function. * Allocation handler:: Using special memory allocation functions. * Error handler:: Using error handler functions. * Logging handler:: Using a special logging function.  File: gcrypt.info, Node: Progress handler, Next: Allocation handler, Up: Handler Functions 4.1 Progress handler ==================== It is often useful to retrieve some feedback while long running operations are performed. -- Data type: gcry_handler_progress_t Progress handler functions have to be of the type `gcry_handler_progress_t', which is defined as: `void (*gcry_handler_progress_t) (void *, const char *, int, int, int)' The following function may be used to register a handler function for this purpose. -- Function: void gcry_set_progress_handler (gcry_handler_progress_t CB, void *CB_DATA) This function installs CB as the `Progress handler' function. It may be used only during initialization. CB must be defined as follows: void my_progress_handler (void *CB_DATA, const char *WHAT, int PRINTCHAR, int CURRENT, int TOTAL) { /* Do something. */ } A description of the arguments of the progress handler function follows. CB_DATA The argument provided in the call to `gcry_set_progress_handler'. WHAT A string identifying the type of the progress output. The following values for WHAT are defined: `need_entropy' Not enough entropy is available. TOTAL holds the number of required bytes. `primegen' Values for PRINTCHAR: `\n' Prime generated. `!' Need to refresh the pool of prime numbers. `<, >' Number of bits adjusted. `^' Searching for a generator. `.' Fermat test on 10 candidates failed. `:' Restart with a new random value. `+' Rabin Miller test passed.  File: gcrypt.info, Node: Allocation handler, Next: Error handler, Prev: Progress handler, Up: Handler Functions 4.2 Allocation handler ====================== It is possible to make Libgcrypt use special memory allocation functions instead of the built-in ones. Memory allocation functions are of the following types: -- Data type: gcry_handler_alloc_t This type is defined as: `void *(*gcry_handler_alloc_t) (size_t n)'. -- Data type: gcry_handler_secure_check_t This type is defined as: `int *(*gcry_handler_secure_check_t) (const void *)'. -- Data type: gcry_handler_realloc_t This type is defined as: `void *(*gcry_handler_realloc_t) (void *p, size_t n)'. -- Data type: gcry_handler_free_t This type is defined as: `void *(*gcry_handler_free_t) (void *)'. Special memory allocation functions can be installed with the following function: -- Function: void gcry_set_allocation_handler (gcry_handler_alloc_t FUNC_ALLOC, gcry_handler_alloc_t FUNC_ALLOC_SECURE, gcry_handler_secure_check_t FUNC_SECURE_CHECK, gcry_handler_realloc_t FUNC_REALLOC, gcry_handler_free_t FUNC_FREE) Install the provided functions and use them instead of the built-in functions for doing memory allocation. Using this function is in general not recommended because the standard Libgcrypt allocation functions are guaranteed to zeroize memory if needed. This function may be used only during initialization and may not be used in fips mode.  File: gcrypt.info, Node: Error handler, Next: Logging handler, Prev: Allocation handler, Up: Handler Functions 4.3 Error handler ================= The following functions may be used to register handler functions that are called by Libgcrypt in case certain error conditions occur. They may and should be registered prior to calling `gcry_check_version'. -- Data type: gcry_handler_no_mem_t This type is defined as: `int (*gcry_handler_no_mem_t) (void *, size_t, unsigned int)' -- Function: void gcry_set_outofcore_handler (gcry_handler_no_mem_t FUNC_NO_MEM, void *CB_DATA) This function registers FUNC_NO_MEM as `out-of-core handler', which means that it will be called in the case of not having enough memory available. The handler is called with 3 arguments: The first one is the pointer CB_DATA as set with this function, the second is the requested memory size and the last being a flag. If bit 0 of the flag is set, secure memory has been requested. The handler should either return true to indicate that Libgcrypt should try again allocating memory or return false to let Libgcrypt use its default fatal error handler. -- Data type: gcry_handler_error_t This type is defined as: `void (*gcry_handler_error_t) (void *, int, const char *)' -- Function: void gcry_set_fatalerror_handler (gcry_handler_error_t FUNC_ERROR, void *CB_DATA) This function registers FUNC_ERROR as `error handler', which means that it will be called in error conditions.  File: gcrypt.info, Node: Logging handler, Prev: Error handler, Up: Handler Functions 4.4 Logging handler =================== -- Data type: gcry_handler_log_t This type is defined as: `void (*gcry_handler_log_t) (void *, int, const char *, va_list)' -- Function: void gcry_set_log_handler (gcry_handler_log_t FUNC_LOG, void *CB_DATA) This function registers FUNC_LOG as `logging handler', which means that it will be called in case Libgcrypt wants to log a message. This function may and should be used prior to calling `gcry_check_version'.  File: gcrypt.info, Node: Symmetric cryptography, Next: Public Key cryptography, Prev: Handler Functions, Up: Top 5 Symmetric cryptography ************************ The cipher functions are used for symmetrical cryptography, i.e. cryptography using a shared key. The programming model follows an open/process/close paradigm and is in that similar to other building blocks provided by Libgcrypt. * Menu: * Available ciphers:: List of ciphers supported by the library. * Cipher modules:: How to work with cipher modules. * Available cipher modes:: List of cipher modes supported by the library. * Working with cipher handles:: How to perform operations related to cipher handles. * General cipher functions:: General cipher functions independent of cipher handles.  File: gcrypt.info, Node: Available ciphers, Next: Cipher modules, Up: Symmetric cryptography 5.1 Available ciphers ===================== `GCRY_CIPHER_NONE' This is not a real algorithm but used by some functions as error return. The value always evaluates to false. `GCRY_CIPHER_IDEA' This is the IDEA algorithm. The constant is provided but there is currently no implementation for it because the algorithm is patented. `GCRY_CIPHER_3DES' Triple-DES with 3 Keys as EDE. The key size of this algorithm is 168 but you have to pass 192 bits because the most significant bits of each byte are ignored. `GCRY_CIPHER_CAST5' CAST128-5 block cipher algorithm. The key size is 128 bits. `GCRY_CIPHER_BLOWFISH' The blowfish algorithm. The current implementation allows only for a key size of 128 bits. `GCRY_CIPHER_SAFER_SK128' Reserved and not currently implemented. `GCRY_CIPHER_DES_SK' Reserved and not currently implemented. `GCRY_CIPHER_AES' `GCRY_CIPHER_AES128' `GCRY_CIPHER_RIJNDAEL' `GCRY_CIPHER_RIJNDAEL128' AES (Rijndael) with a 128 bit key. `GCRY_CIPHER_AES192' `GCRY_CIPHER_RIJNDAEL192' AES (Rijndael) with a 192 bit key. `GCRY_CIPHER_AES256' `GCRY_CIPHER_RIJNDAEL256' AES (Rijndael) with a 256 bit key. `GCRY_CIPHER_TWOFISH' The Twofish algorithm with a 256 bit key. `GCRY_CIPHER_TWOFISH128' The Twofish algorithm with a 128 bit key. `GCRY_CIPHER_ARCFOUR' An algorithm which is 100% compatible with RSA Inc.'s RC4 algorithm. Note that this is a stream cipher and must be used very carefully to avoid a couple of weaknesses. `GCRY_CIPHER_DES' Standard DES with a 56 bit key. You need to pass 64 bit but the high bits of each byte are ignored. Note, that this is a weak algorithm which can be broken in reasonable time using a brute force approach. `GCRY_CIPHER_SERPENT128' `GCRY_CIPHER_SERPENT192' `GCRY_CIPHER_SERPENT256' The Serpent cipher from the AES contest. `GCRY_CIPHER_RFC2268_40' `GCRY_CIPHER_RFC2268_128' Ron's Cipher 2 in the 40 and 128 bit variants. Note, that we currently only support the 40 bit variant. The identifier for 128 is reserved for future use. `GCRY_CIPHER_SEED' A 128 bit cipher as described by RFC4269. `GCRY_CIPHER_CAMELLIA128' `GCRY_CIPHER_CAMELLIA192' `GCRY_CIPHER_CAMELLIA256' The Camellia cipher by NTT. See `http://info.isl.ntt.co.jp/crypt/eng/camellia/specifications.html'.  File: gcrypt.info, Node: Cipher modules, Next: Available cipher modes, Prev: Available ciphers, Up: Symmetric cryptography 5.2 Cipher modules ================== Libgcrypt makes it possible to load additional `cipher modules'; these ciphers can be used just like the cipher algorithms that are built into the library directly. For an introduction into extension modules, see *Note Modules::. -- Data type: gcry_cipher_spec_t This is the `module specification structure' needed for registering cipher modules, which has to be filled in by the user before it can be used to register a module. It contains the following members: `const char *name' The primary name of the algorithm. `const char **aliases' A list of strings that are `aliases' for the algorithm. The list must be terminated with a NULL element. `gcry_cipher_oid_spec_t *oids' A list of OIDs that are to be associated with the algorithm. The list's last element must have it's `oid' member set to NULL. See below for an explanation of this type. `size_t blocksize' The block size of the algorithm, in bytes. `size_t keylen' The length of the key, in bits. `size_t contextsize' The size of the algorithm-specific `context', that should be allocated for each handle. `gcry_cipher_setkey_t setkey' The function responsible for initializing a handle with a provided key. See below for a description of this type. `gcry_cipher_encrypt_t encrypt' The function responsible for encrypting a single block. See below for a description of this type. `gcry_cipher_decrypt_t decrypt' The function responsible for decrypting a single block. See below for a description of this type. `gcry_cipher_stencrypt_t stencrypt' Like `encrypt', for stream ciphers. See below for a description of this type. `gcry_cipher_stdecrypt_t stdecrypt' Like `decrypt', for stream ciphers. See below for a description of this type. -- Data type: gcry_cipher_oid_spec_t This type is used for associating a user-provided algorithm implementation with certain OIDs. It contains the following members: `const char *oid' Textual representation of the OID. `int mode' Cipher mode for which this OID is valid. -- Data type: gcry_cipher_setkey_t Type for the `setkey' function, defined as: gcry_err_code_t (*gcry_cipher_setkey_t) (void *c, const unsigned char *key, unsigned keylen) -- Data type: gcry_cipher_encrypt_t Type for the `encrypt' function, defined as: gcry_err_code_t (*gcry_cipher_encrypt_t) (void *c, const unsigned char *outbuf, const unsigned char *inbuf) -- Data type: gcry_cipher_decrypt_t Type for the `decrypt' function, defined as: gcry_err_code_t (*gcry_cipher_decrypt_t) (void *c, const unsigned char *outbuf, const unsigned char *inbuf) -- Data type: gcry_cipher_stencrypt_t Type for the `stencrypt' function, defined as: gcry_err_code_t (*gcry_cipher_stencrypt_t) (void *c, const unsigned char *outbuf, const unsigned char *, unsigned int n) -- Data type: gcry_cipher_stdecrypt_t Type for the `stdecrypt' function, defined as: gcry_err_code_t (*gcry_cipher_stdecrypt_t) (void *c, const unsigned char *outbuf, const unsigned char *, unsigned int n) -- Function: gcry_error_t gcry_cipher_register (gcry_cipher_spec_t *CIPHER, unsigned int *algorithm_id, gcry_module_t *MODULE) Register a new cipher module whose specification can be found in CIPHER. On success, a new algorithm ID is stored in ALGORITHM_ID and a pointer representing this module is stored in MODULE. -- Function: void gcry_cipher_unregister (gcry_module_t MODULE) Unregister the cipher identified by MODULE, which must have been registered with gcry_cipher_register. -- Function: gcry_error_t gcry_cipher_list (int *LIST, int *LIST_LENGTH) Get a list consisting of the IDs of the loaded cipher modules. If LIST is zero, write the number of loaded cipher modules to LIST_LENGTH and return. If LIST is non-zero, the first *LIST_LENGTH algorithm IDs are stored in LIST, which must be of according size. In case there are less cipher modules than *LIST_LENGTH, *LIST_LENGTH is updated to the correct number.  File: gcrypt.info, Node: Available cipher modes, Next: Working with cipher handles, Prev: Cipher modules, Up: Symmetric cryptography 5.3 Available cipher modes ========================== `GCRY_CIPHER_MODE_NONE' No mode specified. This should not be used. The only exception is that if Libgcrypt is not used in FIPS mode and if any debug flag has been set, this mode may be used to bypass the actual encryption. `GCRY_CIPHER_MODE_ECB' Electronic Codebook mode. `GCRY_CIPHER_MODE_CFB' Cipher Feedback mode. The shift size equals the block size of the cipher (e.g. for AES it is CFB-128). `GCRY_CIPHER_MODE_CBC' Cipher Block Chaining mode. `GCRY_CIPHER_MODE_STREAM' Stream mode, only to be used with stream cipher algorithms. `GCRY_CIPHER_MODE_OFB' Output Feedback mode. `GCRY_CIPHER_MODE_CTR' Counter mode.  File: gcrypt.info, Node: Working with cipher handles, Next: General cipher functions, Prev: Available cipher modes, Up: Symmetric cryptography 5.4 Working with cipher handles =============================== To use a cipher algorithm, you must first allocate an according handle. This is to be done using the open function: -- Function: gcry_error_t gcry_cipher_open (gcry_cipher_hd_t *HD, int ALGO, int MODE, unsigned int FLAGS) This function creates the context handle required for most of the other cipher functions and returns a handle to it in `hd'. In case of an error, an according error code is returned. The ID of algorithm to use must be specified via ALGO. See *Note Available ciphers::, for a list of supported ciphers and the according constants. Besides using the constants directly, the function `gcry_cipher_map_name' may be used to convert the textual name of an algorithm into the according numeric ID. The cipher mode to use must be specified via MODE. See *Note Available cipher modes::, for a list of supported cipher modes and the according constants. Note that some modes are incompatible with some algorithms - in particular, stream mode (`GCRY_CIPHER_MODE_STREAM') only works with stream ciphers. Any block cipher mode (`GCRY_CIPHER_MODE_ECB', `GCRY_CIPHER_MODE_CBC', `GCRY_CIPHER_MODE_CFB', `GCRY_CIPHER_MODE_OFB' or `GCRY_CIPHER_MODE_CTR') will work with any block cipher algorithm. The third argument FLAGS can either be passed as `0' or as the bit-wise OR of the following constants. `GCRY_CIPHER_SECURE' Make sure that all operations are allocated in secure memory. This is useful when the key material is highly confidential. `GCRY_CIPHER_ENABLE_SYNC' This flag enables the CFB sync mode, which is a special feature of Libgcrypt's CFB mode implementation to allow for OpenPGP's CFB variant. See `gcry_cipher_sync'. `GCRY_CIPHER_CBC_CTS' Enable cipher text stealing (CTS) for the CBC mode. Cannot be used simultaneous as GCRY_CIPHER_CBC_MAC. CTS mode makes it possible to transform data of almost arbitrary size (only limitation is that it must be greater than the algorithm's block size). `GCRY_CIPHER_CBC_MAC' Compute CBC-MAC keyed checksums. This is the same as CBC mode, but only output the last block. Cannot be used simultaneous as GCRY_CIPHER_CBC_CTS. Use the following function to release an existing handle: -- Function: void gcry_cipher_close (gcry_cipher_hd_t H) This function releases the context created by `gcry_cipher_open'. In order to use a handle for performing cryptographic operations, a `key' has to be set first: -- Function: gcry_error_t gcry_cipher_setkey (gcry_cipher_hd_t H, const void *K, size_t L) Set the key K used for encryption or decryption in the context denoted by the handle H. The length L of the key K must match the required length of the algorithm set for this context or be in the allowed range for algorithms with variable key size. The function checks this and returns an error if there is a problem. A caller should always check for an error. Most crypto modes requires an initialization vector (IV), which usually is a non-secret random string acting as a kind of salt value. The CTR mode requires a counter, which is also similar to a salt value. To set the IV or CTR, use these functions: -- Function: gcry_error_t gcry_cipher_setiv (gcry_cipher_hd_t H, const void *K, size_t L) Set the initialization vector used for encryption or decryption. The vector is passed as the buffer K of length L and copied to internal data structures. The function checks that the IV matches the requirement of the selected algorithm and mode. -- Function: gcry_error_t gcry_cipher_setctr (gcry_cipher_hd_t H, const void *C, size_t L) Set the counter vector used for encryption or decryption. The counter is passed as the buffer C of length L and copied to internal data structures. The function checks that the counter matches the requirement of the selected algorithm (i.e., it must be the same size as the block size). -- Function: gcry_error_t gcry_cipher_reset (gcry_cipher_hd_t H) Set the given handle's context back to the state it had after the last call to gcry_cipher_setkey and clear the initialization vector. Note that gcry_cipher_reset is implemented as a macro. The actual encryption and decryption is done by using one of the following functions. They may be used as often as required to process all the data. -- Function: gcry_error_t gcry_cipher_encrypt (gcry_cipher_hd_t H, unsigned char *out, size_t OUTSIZE, const unsigned char *IN, size_t INLEN) `gcry_cipher_encrypt' is used to encrypt the data. This function can either work in place or with two buffers. It uses the cipher context already setup and described by the handle H. There are 2 ways to use the function: If IN is passed as `NULL' and INLEN is `0', in-place encryption of the data in OUT or length OUTSIZE takes place. With IN being not `NULL', INLEN bytes are encrypted to the buffer OUT which must have at least a size of INLEN. OUTSIZE must be set to the allocated size of OUT, so that the function can check that there is sufficient space. Note that overlapping buffers are not allowed. Depending on the selected algorithms and encryption mode, the length of the buffers must be a multiple of the block size. The function returns `0' on success or an error code. -- Function: gcry_error_t gcry_cipher_decrypt (gcry_cipher_hd_t H, unsigned char *out, size_t OUTSIZE, const unsigned char *IN, size_t INLEN) `gcry_cipher_decrypt' is used to decrypt the data. This function can either work in place or with two buffers. It uses the cipher context already setup and described by the handle H. There are 2 ways to use the function: If IN is passed as `NULL' and INLEN is `0', in-place decryption of the data in OUT or length OUTSIZE takes place. With IN being not `NULL', INLEN bytes are decrypted to the buffer OUT which must have at least a size of INLEN. OUTSIZE must be set to the allocated size of OUT, so that the function can check that there is sufficient space. Note that overlapping buffers are not allowed. Depending on the selected algorithms and encryption mode, the length of the buffers must be a multiple of the block size. The function returns `0' on success or an error code. OpenPGP (as defined in RFC-2440) requires a special sync operation in some places. The following function is used for this: -- Function: gcry_error_t gcry_cipher_sync (gcry_cipher_hd_t H) Perform the OpenPGP sync operation on context H. Note that this is a no-op unless the context was created with the flag `GCRY_CIPHER_ENABLE_SYNC' Some of the described functions are implemented as macros utilizing a catch-all control function. This control function is rarely used directly but there is nothing which would inhibit it: -- Function: gcry_error_t gcry_cipher_ctl (gcry_cipher_hd_t H, int CMD, void *BUFFER, size_t BUFLEN) `gcry_cipher_ctl' controls various aspects of the cipher module and specific cipher contexts. Usually some more specialized functions or macros are used for this purpose. The semantics of the function and its parameters depends on the the command CMD and the passed context handle H. Please see the comments in the source code (`src/global.c') for details. -- Function: gcry_error_t gcry_cipher_info (gcry_cipher_hd_t H, int WHAT, void *BUFFER, size_t *NBYTES) `gcry_cipher_info' is used to retrieve various information about a cipher context or the cipher module in general. Currently no information is available.  File: gcrypt.info, Node: General cipher functions, Prev: Working with cipher handles, Up: Symmetric cryptography 5.5 General cipher functions ============================ To work with the algorithms, several functions are available to map algorithm names to the internal identifiers, as well as ways to retrieve information about an algorithm or the current cipher context. -- Function: gcry_error_t gcry_cipher_algo_info (int ALGO, int WHAT, void *BUFFER, size_t *NBYTES) This function is used to retrieve information on a specific algorithm. You pass the cipher algorithm ID as ALGO and the type of information requested as WHAT. The result is either returned as the return code of the function or copied to the provided BUFFER whose allocated length must be available in an integer variable with the address passed in NBYTES. This variable will also receive the actual used length of the buffer. Here is a list of supported codes for WHAT: `GCRYCTL_GET_KEYLEN:' Return the length of the key. If the algorithm supports multiple key lengths, the maximum supported value is returned. The length is returned as number of octets (bytes) and not as number of bits in NBYTES; BUFFER must be zero. `GCRYCTL_GET_BLKLEN:' Return the block length of the algorithm. The length is returned as a number of octets in NBYTES; BUFFER must be zero. `GCRYCTL_TEST_ALGO:' Returns `0' when the specified algorithm is available for use. BUFFER and NBYTES must be zero. -- Function: const char * gcry_cipher_algo_name (int ALGO) `gcry_cipher_algo_name' returns a string with the name of the cipher algorithm ALGO. If the algorithm is not known or another error occurred, the string `"?"' is returned. This function should not be used to test for the availability of an algorithm. -- Function: int gcry_cipher_map_name (const char *NAME) `gcry_cipher_map_name' returns the algorithm identifier for the cipher algorithm described by the string NAME. If this algorithm is not available `0' is returned. -- Function: int gcry_cipher_mode_from_oid (const char *STRING) Return the cipher mode associated with an ASN.1 object identifier. The object identifier is expected to be in the IETF-style dotted decimal notation. The function returns `0' for an unknown object identifier or when no mode is associated with it.  File: gcrypt.info, Node: Public Key cryptography, Next: Hashing, Prev: Symmetric cryptography, Up: Top 6 Public Key cryptography ************************* Public key cryptography, also known as asymmetric cryptography, is an easy way for key management and to provide digital signatures. Libgcrypt provides two completely different interfaces to public key cryptography, this chapter explains the one based on S-expressions. * Menu: * Available algorithms:: Algorithms supported by the library. * Used S-expressions:: Introduction into the used S-expression. * Public key modules:: How to work with public key modules. * Cryptographic Functions:: Functions for performing the cryptographic actions. * General public-key related Functions:: General functions, not implementing any cryptography. * AC Interface:: Alternative interface to public key functions.  File: gcrypt.info, Node: Available algorithms, Next: Used S-expressions, Up: Public Key cryptography 6.1 Available algorithms ======================== Libgcrypt supports the RSA (Rivest-Shamir-Adleman) algorithms as well as DSA (Digital Signature Algorithm) and Elgamal. The versatile interface allows to add more algorithms in the future.  File: gcrypt.info, Node: Used S-expressions, Next: Public key modules, Prev: Available algorithms, Up: Public Key cryptography 6.2 Used S-expressions ====================== Libgcrypt's API for asymmetric cryptography is based on data structures called S-expressions (see `http://people.csail.mit.edu/rivest/sexp.html') and does not work with contexts as most of the other building blocks of Libgcrypt do. The following information are stored in S-expressions: keys plain text data encrypted data signatures To describe how Libgcrypt expect keys, we use examples. Note that words in uppercase indicate parameters whereas lowercase words are literals. Note that all MPI (multi-precision-integers) values are expected to be in `GCRYMPI_FMT_USG' format. An easy way to create S-expressions is by using `gcry_sexp_build' which allows to pass a string with printf-like escapes to insert MPI values. * Menu: * RSA key parameters:: Parameters used with an RSA key. * DSA key parameters:: Parameters used with a DSA key. * ECC key parameters:: Parameters used with ECC keys.  File: gcrypt.info, Node: RSA key parameters, Next: DSA key parameters, Up: Used S-expressions 6.2.1 RSA key parameters ------------------------ An RSA private key is described by this S-expression: (private-key (rsa (n N-MPI) (e E-MPI) (d D-MPI) (p P-MPI) (q Q-MPI) (u U-MPI))) An RSA public key is described by this S-expression: (public-key (rsa (n N-MPI) (e E-MPI))) N-MPI RSA public modulus n. E-MPI RSA public exponent e. D-MPI RSA secret exponent d = e^-1 \bmod (p-1)(q-1). P-MPI RSA secret prime p. Q-MPI RSA secret prime q with p < q. U-MPI Multiplicative inverse u = p^-1 \bmod q. For signing and decryption the parameters (p, q, u) are optional but greatly improve the performance. Either all of these optional parameters must be given or none of them. They are mandatory for gcry_pk_testkey. Note that OpenSSL uses slighly different parameters: q < p and u = q^-1 \bmod p. To use these parameters you will need to swap the values and recompute u. Here is example code to do this: if (gcry_mpi_cmp (p, q) > 0) { gcry_mpi_swap (p, q); gcry_mpi_invm (u, p, q); }  File: gcrypt.info, Node: DSA key parameters, Next: ECC key parameters, Prev: RSA key parameters, Up: Used S-expressions 6.2.2 DSA key parameters ------------------------ A DSA private key is described by this S-expression: (private-key (dsa (p P-MPI) (q Q-MPI) (g G-MPI) (y Y-MPI) (x X-MPI))) P-MPI DSA prime p. Q-MPI DSA group order q (which is a prime divisor of p-1). G-MPI DSA group generator g. Y-MPI DSA public key value y = g^x \bmod p. X-MPI DSA secret exponent x. The public key is similar with "private-key" replaced by "public-key" and no X-MPI.  File: gcrypt.info, Node: ECC key parameters, Prev: DSA key parameters, Up: Used S-expressions 6.2.3 ECC key parameters ------------------------ An ECC private key is described by this S-expression: (private-key (ecc (p P-MPI) (a A-MPI) (b B-MPI) (g G-POINT) (n N-MPI) (q Q-POINT) (d D-MPI))) P-MPI Prime specifying the field GF(p). A-MPI B-MPI The two coefficients of the Weierstrass equation y^2 = x^3 + ax + b G-POINT Base point g. N-MPI Order of g Q-POINT The point representing the public key Q = dP. D-MPI The private key d All point values are encoded in standard format; Libgcrypt does currently only support uncompressed points, thus the first byte needs to be `0x04'. The public key is similar with "private-key" replaced by "public-key" and no D-MPI. If the domain parameters are well-known, the name of this curve may be used. For example (private-key (ecc (curve "NIST P-192") (q Q-POINT) (d D-MPI))) The `curve' parameter may be given in any case and is used to replace missing parameters. Currently implemented curves are: `NIST P-192' `1.2.840.10045.3.1.1' `prime192v1' `secp192r1' The NIST 192 bit curve, its OID, X9.62 and SECP aliases. `NIST P-224' `secp224r1' The NIST 224 bit curve and its SECP alias. `NIST P-256' `1.2.840.10045.3.1.7' `prime256v1' `secp256r1' The NIST 256 bit curve, its OID, X9.62 and SECP aliases. `NIST P-384' `secp384r1' The NIST 384 bit curve and its SECP alias. `NIST P-521' `secp521r1' The NIST 521 bit curve and its SECP alias. As usual the OIDs may optionally be prefixed with the string `OID.' or `oid.'.  File: gcrypt.info, Node: Public key modules, Next: Cryptographic Functions, Prev: Used S-expressions, Up: Public Key cryptography 6.3 Public key modules ====================== Libgcrypt makes it possible to load additional `public key modules'; these public key algorithms can be used just like the algorithms that are built into the library directly. For an introduction into extension modules, see *Note Modules::. -- Data type: gcry_pk_spec_t This is the `module specification structure' needed for registering public key modules, which has to be filled in by the user before it can be used to register a module. It contains the following members: `const char *name' The primary name of this algorithm. `char **aliases' A list of strings that are `aliases' for the algorithm. The list must be terminated with a NULL element. `const char *elements_pkey' String containing the one-letter names of the MPI values contained in a public key. `const char *element_skey' String containing the one-letter names of the MPI values contained in a secret key. `const char *elements_enc' String containing the one-letter names of the MPI values that are the result of an encryption operation using this algorithm. `const char *elements_sig' String containing the one-letter names of the MPI values that are the result of a sign operation using this algorithm. `const char *elements_grip' String containing the one-letter names of the MPI values that are to be included in the `key grip'. `int use' The bitwise-OR of the following flags, depending on the abilities of the algorithm: `GCRY_PK_USAGE_SIGN' The algorithm supports signing and verifying of data. `GCRY_PK_USAGE_ENCR' The algorithm supports the encryption and decryption of data. `gcry_pk_generate_t generate' The function responsible for generating a new key pair. See below for a description of this type. `gcry_pk_check_secret_key_t check_secret_key' The function responsible for checking the sanity of a provided secret key. See below for a description of this type. `gcry_pk_encrypt_t encrypt' The function responsible for encrypting data. See below for a description of this type. `gcry_pk_decrypt_t decrypt' The function responsible for decrypting data. See below for a description of this type. `gcry_pk_sign_t sign' The function responsible for signing data. See below for a description of this type. `gcry_pk_verify_t verify' The function responsible for verifying that the provided signature matches the provided data. See below for a description of this type. `gcry_pk_get_nbits_t get_nbits' The function responsible for returning the number of bits of a provided key. See below for a description of this type. -- Data type: gcry_pk_generate_t Type for the `generate' function, defined as: gcry_err_code_t (*gcry_pk_generate_t) (int algo, unsigned int nbits, unsigned long use_e, gcry_mpi_t *skey, gcry_mpi_t **retfactors) -- Data type: gcry_pk_check_secret_key_t Type for the `check_secret_key' function, defined as: gcry_err_code_t (*gcry_pk_check_secret_key_t) (int algo, gcry_mpi_t *skey) -- Data type: gcry_pk_encrypt_t Type for the `encrypt' function, defined as: gcry_err_code_t (*gcry_pk_encrypt_t) (int algo, gcry_mpi_t *resarr, gcry_mpi_t data, gcry_mpi_t *pkey, int flags) -- Data type: gcry_pk_decrypt_t Type for the `decrypt' function, defined as: gcry_err_code_t (*gcry_pk_decrypt_t) (int algo, gcry_mpi_t *result, gcry_mpi_t *data, gcry_mpi_t *skey, int flags) -- Data type: gcry_pk_sign_t Type for the `sign' function, defined as: gcry_err_code_t (*gcry_pk_sign_t) (int algo, gcry_mpi_t *resarr, gcry_mpi_t data, gcry_mpi_t *skey) -- Data type: gcry_pk_verify_t Type for the `verify' function, defined as: gcry_err_code_t (*gcry_pk_verify_t) (int algo, gcry_mpi_t hash, gcry_mpi_t *data, gcry_mpi_t *pkey, int (*cmp) (void *, gcry_mpi_t), void *opaquev) -- Data type: gcry_pk_get_nbits_t Type for the `get_nbits' function, defined as: unsigned (*gcry_pk_get_nbits_t) (int algo, gcry_mpi_t *pkey) -- Function: gcry_error_t gcry_pk_register (gcry_pk_spec_t *PUBKEY, unsigned int *algorithm_id, gcry_module_t *MODULE) Register a new public key module whose specification can be found in PUBKEY. On success, a new algorithm ID is stored in ALGORITHM_ID and a pointer representing this module is stored in MODULE. -- Function: void gcry_pk_unregister (gcry_module_t MODULE) Unregister the public key module identified by MODULE, which must have been registered with gcry_pk_register. -- Function: gcry_error_t gcry_pk_list (int *LIST, int *LIST_LENGTH) Get a list consisting of the IDs of the loaded pubkey modules. If LIST is zero, write the number of loaded pubkey modules to LIST_LENGTH and return. If LIST is non-zero, the first *LIST_LENGTH algorithm IDs are stored in LIST, which must be of according size. In case there are less pubkey modules than *LIST_LENGTH, *LIST_LENGTH is updated to the correct number.  File: gcrypt.info, Node: Cryptographic Functions, Next: General public-key related Functions, Prev: Public key modules, Up: Public Key cryptography 6.4 Cryptographic Functions =========================== Note that we will in future allow to use keys without p,q and u specified and may also support other parameters for performance reasons. Some functions operating on S-expressions support `flags', that influence the operation. These flags have to be listed in a sub-S-expression named `flags'; the following flags are known: `pkcs1' Use PKCS#1 block type 2 padding. `no-blinding' Do not use a technique called `blinding', which is used by default in order to prevent leaking of secret information. Blinding is only implemented by RSA, but it might be implemented by other algorithms in the future as well, when necessary. Now that we know the key basics, we can carry on and explain how to encrypt and decrypt data. In almost all cases the data is a random session key which is in turn used for the actual encryption of the real data. There are 2 functions to do this: -- Function: gcry_error_t gcry_pk_encrypt (gcry_sexp_t *R_CIPH, gcry_sexp_t DATA, gcry_sexp_t PKEY) Obviously a public key must be provided for encryption. It is expected as an appropriate S-expression (see above) in PKEY. The data to be encrypted can either be in the simple old format, which is a very simple S-expression consisting only of one MPI, or it may be a more complex S-expression which also allows to specify flags for operation, like e.g. padding rules. If you don't want to let Libgcrypt handle the padding, you must pass an appropriate MPI using this expression for DATA: (data (flags raw) (value MPI)) This has the same semantics as the old style MPI only way. MPI is the actual data, already padded appropriate for your protocol. Most systems however use PKCS#1 padding and so you can use this S-expression for DATA: (data (flags pkcs1) (value BLOCK)) Here, the "flags" list has the "pkcs1" flag which let the function know that it should provide PKCS#1 block type 2 padding. The actual data to be encrypted is passed as a string of octets in BLOCK. The function checks that this data actually can be used with the given key, does the padding and encrypts it. If the function could successfully perform the encryption, the return value will be 0 and a new S-expression with the encrypted result is allocated and assigned to the variable at the address of R_CIPH. The caller is responsible to release this value using `gcry_sexp_release'. In case of an error, an error code is returned and R_CIPH will be set to `NULL'. The returned S-expression has this format when used with RSA: (enc-val (rsa (a A-MPI))) Where A-MPI is an MPI with the result of the RSA operation. When using the Elgamal algorithm, the return value will have this format: (enc-val (elg (a A-MPI) (b B-MPI))) Where A-MPI and B-MPI are MPIs with the result of the Elgamal encryption operation. -- Function: gcry_error_t gcry_pk_decrypt (gcry_sexp_t *R_PLAIN, gcry_sexp_t DATA, gcry_sexp_t SKEY) Obviously a private key must be provided for decryption. It is expected as an appropriate S-expression (see above) in SKEY. The data to be decrypted must match the format of the result as returned by `gcry_pk_encrypt', but should be enlarged with a `flags' element: (enc-val (flags) (elg (a A-MPI) (b B-MPI))) Note that this function currently does not know of any padding methods and the caller must do any un-padding on his own. The function returns 0 on success or an error code. The variable at the address of R_PLAIN will be set to NULL on error or receive the decrypted value on success. The format of R_PLAIN is a simple S-expression part (i.e. not a valid one) with just one MPI if there was no `flags' element in DATA; if at least an empty `flags' is passed in DATA, the format is: (value PLAINTEXT) Another operation commonly performed using public key cryptography is signing data. In some sense this is even more important than encryption because digital signatures are an important instrument for key management. Libgcrypt supports digital signatures using 2 functions, similar to the encryption functions: -- Function: gcry_error_t gcry_pk_sign (gcry_sexp_t *R_SIG, gcry_sexp_t DATA, gcry_sexp_t SKEY) This function creates a digital signature for DATA using the private key SKEY and place it into the variable at the address of R_SIG. DATA may either be the simple old style S-expression with just one MPI or a modern and more versatile S-expression which allows to let Libgcrypt handle padding: (data (flags pkcs1) (hash HASH-ALGO BLOCK)) This example requests to sign the data in BLOCK after applying PKCS#1 block type 1 style padding. HASH-ALGO is a string with the hash algorithm to be encoded into the signature, this may be any hash algorithm name as supported by Libgcrypt. Most likely, this will be "sha1", "rmd160" or "md5". It is obvious that the length of BLOCK must match the size of that message digests; the function checks that this and other constraints are valid. If PKCS#1 padding is not required (because the caller does already provide a padded value), either the old format or better the following format should be used: (data (flags raw) (value MPI)) Here, the data to be signed is directly given as an MPI. The signature is returned as a newly allocated S-expression in R_SIG using this format for RSA: (sig-val (rsa (s S-MPI))) Where S-MPI is the result of the RSA sign operation. For DSA the S-expression returned is: (sig-val (dsa (r R-MPI) (s S-MPI))) Where R-MPI and S-MPI are the result of the DSA sign operation. For Elgamal signing (which is slow, yields large numbers and probably is not as secure as the other algorithms), the same format is used with "elg" replacing "dsa". The operation most commonly used is definitely the verification of a signature. Libgcrypt provides this function: -- Function: gcry_error_t gcry_pk_verify (gcry_sexp_t SIG, gcry_sexp_t DATA, gcry_sexp_t PKEY) This is used to check whether the signature SIG matches the DATA. The public key PKEY must be provided to perform this verification. This function is similar in its parameters to `gcry_pk_sign' with the exceptions that the public key is used instead of the private key and that no signature is created but a signature, in a format as created by `gcry_pk_sign', is passed to the function in SIG. The result is 0 for success (i.e. the data matches the signature), or an error code where the most relevant code is `GCRYERR_BAD_SIGNATURE' to indicate that the signature does not match the provided data.  File: gcrypt.info, Node: General public-key related Functions, Next: AC Interface, Prev: Cryptographic Functions, Up: Public Key cryptography 6.5 General public-key related Functions ======================================== A couple of utility functions are available to retrieve the length of the key, map algorithm identifiers and perform sanity checks: -- Function: const char * gcry_pk_algo_name (int ALGO) Map the public key algorithm id ALGO to a string representation of the algorithm name. For unknown algorithms this functions returns the string `"?"'. This function should not be used to test for the availability of an algorithm. -- Function: int gcry_pk_map_name (const char *NAME) Map the algorithm NAME to a public key algorithm Id. Returns 0 if the algorithm name is not known. -- Function: int gcry_pk_test_algo (int ALGO) Return 0 if the public key algorithm ALGO is available for use. Note that this is implemented as a macro. -- Function: unsigned int gcry_pk_get_nbits (gcry_sexp_t KEY) Return what is commonly referred as the key length for the given public or private in KEY. -- Function: unsigned char * gcry_pk_get_keygrip (gcry_sexp_t KEY, unsigned char *ARRAY) Return the so called "keygrip" which is the SHA-1 hash of the public key parameters expressed in a way depended on the algorithm. ARRAY must either provide space for 20 bytes or be `NULL'. In the latter case a newly allocated array of that size is returned. On success a pointer to the newly allocated space or to ARRAY is returned. `NULL' is returned to indicate an error which is most likely an unknown algorithm or one where a "keygrip" has not yet been defined. The function accepts public or secret keys in KEY. -- Function: gcry_error_t gcry_pk_testkey (gcry_sexp_t KEY) Return zero if the private key KEY is `sane', an error code otherwise. Note that it is not possible to check the `saneness' of a public key. -- Function: gcry_error_t gcry_pk_algo_info (int ALGO, int WHAT, void *BUFFER, size_t *NBYTES) Depending on the value of WHAT return various information about the public key algorithm with the id ALGO. Note that the function returns `-1' on error and the actual error code must be retrieved using the function `gcry_errno'. The currently defined values for WHAT are: `GCRYCTL_TEST_ALGO:' Return 0 if the specified algorithm is available for use. BUFFER must be `NULL', NBYTES may be passed as `NULL' or point to a variable with the required usage of the algorithm. This may be 0 for "don't care" or the bit-wise OR of these flags: `GCRY_PK_USAGE_SIGN' Algorithm is usable for signing. `GCRY_PK_USAGE_ENCR' Algorithm is usable for encryption. Unless you need to test for the allowed usage, it is in general better to use the macro gcry_pk_test_algo instead. `GCRYCTL_GET_ALGO_USAGE:' Return the usage flags for the given algorithm. An invalid algorithm return 0. Disabled algorithms are ignored here because we want to know whether the algorithm is at all capable of a certain usage. `GCRYCTL_GET_ALGO_NPKEY' Return the number of elements the public key for algorithm ALGO consist of. Return 0 for an unknown algorithm. `GCRYCTL_GET_ALGO_NSKEY' Return the number of elements the private key for algorithm ALGO consist of. Note that this value is always larger than that of the public key. Return 0 for an unknown algorithm. `GCRYCTL_GET_ALGO_NSIGN' Return the number of elements a signature created with the algorithm ALGO consists of. Return 0 for an unknown algorithm or for an algorithm not capable of creating signatures. `GCRYCTL_GET_ALGO_NENC' Return the number of elements a encrypted message created with the algorithm ALGO consists of. Return 0 for an unknown algorithm or for an algorithm not capable of encryption. Please note that parameters not required should be passed as `NULL'. -- Function: gcry_error_t gcry_pk_ctl (int CMD, void *BUFFER, size_t BUFLEN) This is a general purpose function to perform certain control operations. CMD controls what is to be done. The return value is 0 for success or an error code. Currently supported values for CMD are: `GCRYCTL_DISABLE_ALGO' Disable the algorithm given as an algorithm id in BUFFER. BUFFER must point to an `int' variable with the algorithm id and BUFLEN must have the value `sizeof (int)'. Libgcrypt also provides a function to generate public key pairs: -- Function: gcry_error_t gcry_pk_genkey (gcry_sexp_t *R_KEY, gcry_sexp_t PARMS) This function create a new public key pair using information given in the S-expression PARMS and stores the private and the public key in one new S-expression at the address given by R_KEY. In case of an error, R_KEY is set to `NULL'. The return code is 0 for success or an error code otherwise. Here is an example for PARMS to create an 2048 bit RSA key: (genkey (rsa (nbits 4:2048))) To create an Elgamal key, substitute "elg" for "rsa" and to create a DSA key use "dsa". Valid ranges for the key length depend on the algorithms; all commonly used key lengths are supported. Currently supported parameters are: `nbits' This is always required to specify the length of the key. The argument is a string with a number in C-notation. The value should be a multiple of 8. `curve NAME' For ECC a named curve may be used instead of giving the number of requested bits. This allows to request a specific curve to override a default selection Libgcrypt would have taken if `nbits' has been given. The available names are listed with the description of the ECC public key parameters. `rsa-use-e' This is only used with RSA to give a hint for the public exponent. The value will be used as a base to test for a usable exponent. Some values are special: `0' Use a secure and fast value. This is currently the number 41. `1' Use a value as required by some crypto policies. This is currently the number 65537. `2' Reserved `> 2' Use the given value. If this parameter is not used, Libgcrypt uses for historic reasons 65537. `qbits' This is only meanigful for DSA keys. If it is given the DSA key is generated with a Q parameyer of this size. If it is not given or zero Q is deduced from NBITS in this way: `512 <= N <= 1024' Q = 160 `N = 2048' Q = 224 `N = 3072' Q = 256 `N = 7680' Q = 384 `N = 15360' Q = 512 Note that in this case only the values for N, as given in the table, are allowed. When specifying Q all values of N in the range 512 to 15680 are valid as long as they are multiples of 8. `transient-key' This is only meaningful for RSA and DSA keys. This is a flag with no value. If given the RSA or DSA key is created using a faster and a somewhat less secure random number generator. This flag may be used for keys which are only used for a short time and do not require full cryptographic strength. `domain' This is only meaningful for DLP algorithms. If specified keys are generated with domain parameters taken from this list. The exact format of this parameter depends on the actual algorithm. It is currently only implemented for DSA using this format: (genkey (dsa (domain (p P-MPI) (q Q-MPI) (g Q-MPI)))) `nbits' and `qbits' may not be specified because they are derived from the domain parameters. `derive-parms' This is currently only implemented for RSA and DSA keys. It is not allowed to use this together with a `domain' specification. If given, it is used to derive the keys using the given parameters. If given for an RSA key the X9.31 key generation algorithm is used even if libgcrypt is not in FIPS mode. If given for a DSA key, the FIPS 186 algorithm is used even if libgcrypt is not in FIPS mode. (genkey (rsa (nbits 4:1024) (rsa-use-e 1:3) (derive-parms (Xp1 #1A1916DDB29B4EB7EB6732E128#) (Xp2 #192E8AAC41C576C822D93EA433#) (Xp #D8CD81F035EC57EFE822955149D3BFF70C53520D 769D6D76646C7A792E16EBD89FE6FC5B605A6493 39DFC925A86A4C6D150B71B9EEA02D68885F5009 B98BD984#) (Xq1 #1A5CF72EE770DE50CB09ACCEA9#) (Xq2 #134E4CAA16D2350A21D775C404#) (Xq #CC1092495D867E64065DEE3E7955F2EBC7D47A2D 7C9953388F97DDDC3E1CA19C35CA659EDC2FC325 6D29C2627479C086A699A49C4C9CEE7EF7BD1B34 321DE34A#)))) (genkey (dsa (nbits 4:1024) (derive-parms (seed SEED-MPI)))) `use-x931' Force the use of the ANSI X9.31 key generation algorithm instead of the default algorithm. This flag is only meaningful for RSA and usually not required. Note that this algorithm is implicitly used if either `derive-parms' is given or Libgcrypt is in FIPS mode. `use-fips186' Force the use of the FIPS 186 key generation algorithm instead of the default algorithm. This flag is only meaningful for DSA and usually not required. Note that this algorithm is implicitly used if either `derive-parms' is given or Libgcrypt is in FIPS mode. As of now FIPS 186-2 is implemented; after the approval of FIPS 186-3 the code will be changed to implement 186-3. `use-fips186-2' Force the use of the FIPS 186-2 key generation algorithm instead of the default algorithm. This algorithm is slighlty different from FIPS 186-3 and allows only 1024 bit keys. This flag is only meaningful for DSA and only required for FIPS testing backward compatibility. The key pair is returned in a format depending on the algorithm. Both private and public keys are returned in one container and may be accompanied by some miscellaneous information. As an example, here is what the Elgamal key generation returns: (key-data (public-key (elg (p P-MPI) (g G-MPI) (y Y-MPI))) (private-key (elg (p P-MPI) (g G-MPI) (y Y-MPI) (x X-MPI))) (misc-key-info (pm1-factors N1 N2 ... NN)) As you can see, some of the information is duplicated, but this provides an easy way to extract either the public or the private key. Note that the order of the elements is not defined, e.g. the private key may be stored before the public key. N1 N2 ... NN is a list of prime numbers used to composite P-MPI; this is in general not a very useful information and only available if the key generation algorithm provides them.  File: gcrypt.info, Node: AC Interface, Prev: General public-key related Functions, Up: Public Key cryptography 6.6 Alternative Public Key Interface ==================================== This section documents the alternative interface to asymmetric cryptography (ac) that is not based on S-expressions, but on native C data structures. As opposed to the pk interface described in the former chapter, this one follows an open/use/close paradigm like other building blocks of the library. *This interface has a few known problems; most noteworthy an inherent tendency to leak memory. It might not be available in forthcoming versions of Libgcrypt.* * Menu: * Available asymmetric algorithms:: List of algorithms supported by the library. * Working with sets of data:: How to work with sets of data. * Working with IO objects:: How to work with IO objects. * Working with handles:: How to use handles. * Working with keys:: How to work with keys. * Using cryptographic functions:: How to perform cryptographic operations. * Handle-independent functions:: General functions independent of handles.  File: gcrypt.info, Node: Available asymmetric algorithms, Next: Working with sets of data, Up: AC Interface 6.6.1 Available asymmetric algorithms ------------------------------------- Libgcrypt supports the RSA (Rivest-Shamir-Adleman) algorithms as well as DSA (Digital Signature Algorithm) and Elgamal. The versatile interface allows to add more algorithms in the future. -- Data type: gcry_ac_id_t The following constants are defined for this type: `GCRY_AC_RSA' Rivest-Shamir-Adleman `GCRY_AC_DSA' Digital Signature Algorithm `GCRY_AC_ELG' Elgamal `GCRY_AC_ELG_E' Elgamal, encryption only.  File: gcrypt.info, Node: Working with sets of data, Next: Working with IO objects, Prev: Available asymmetric algorithms, Up: AC Interface 6.6.2 Working with sets of data ------------------------------- In the context of this interface the term `data set' refers to a list of `named MPI values' that is used by functions performing cryptographic operations; a named MPI value is a an MPI value, associated with a label. Such data sets are used for representing keys, since keys simply consist of a variable amount of numbers. Furthermore some functions return data sets to the caller that are to be provided to other functions. This section documents the data types, symbols and functions that are relevant for working with data sets. -- Data type: gcry_ac_data_t A single data set. The following flags are supported: `GCRY_AC_FLAG_DEALLOC' Used for storing data in a data set. If given, the data will be released by the library. Note that whenever one of the ac functions is about to release objects because of this flag, the objects are expected to be stored in memory allocated through the Libgcrypt memory management. In other words: gcry_free() is used instead of free(). `GCRY_AC_FLAG_COPY' Used for storing/retrieving data in/from a data set. If given, the library will create copies of the provided/contained data, which will then be given to the user/associated with the data set. -- Function: gcry_error_t gcry_ac_data_new (gcry_ac_data_t *DATA) Creates a new, empty data set and stores it in DATA. -- Function: void gcry_ac_data_destroy (gcry_ac_data_t DATA) Destroys the data set DATA. -- Function: gcry_error_t gcry_ac_data_set (gcry_ac_data_t DATA, unsigned int FLAGS, char *NAME, gcry_mpi_t MPI) Add the value MPI to DATA with the label NAME. If FLAGS contains GCRY_AC_FLAG_COPY, the data set will contain copies of NAME and MPI. If FLAGS contains GCRY_AC_FLAG_DEALLOC or GCRY_AC_FLAG_COPY, the values contained in the data set will be deallocated when they are to be removed from the data set. -- Function: gcry_error_t gcry_ac_data_copy (gcry_ac_data_t *DATA_CP, gcry_ac_data_t DATA) Create a copy of the data set DATA and store it in DATA_CP. FIXME: exact semantics undefined. -- Function: unsigned int gcry_ac_data_length (gcry_ac_data_t DATA) Returns the number of named MPI values inside of the data set DATA. -- Function: gcry_error_t gcry_ac_data_get_name (gcry_ac_data_t DATA, unsigned int FLAGS, char *NAME, gcry_mpi_t *MPI) Store the value labelled with NAME found in DATA in MPI. If FLAGS contains GCRY_AC_FLAG_COPY, store a copy of the MPI value contained in the data set. MPI may be NULL (this might be useful for checking the existence of an MPI with extracting it). -- Function: gcry_error_t gcry_ac_data_get_index (gcry_ac_data_t DATA, unsigned int flags, unsigned int INDEX, const char **NAME, gcry_mpi_t *MPI) Stores in NAME and MPI the named MPI value contained in the data set DATA with the index IDX. If FLAGS contains GCRY_AC_FLAG_COPY, store copies of the values contained in the data set. NAME or MPI may be NULL. -- Function: void gcry_ac_data_clear (gcry_ac_data_t DATA) Destroys any values contained in the data set DATA. -- Function: gcry_error_t gcry_ac_data_to_sexp (gcry_ac_data_t DATA, gcry_sexp_t *SEXP, const char **IDENTIFIERS) This function converts the data set DATA into a newly created S-Expression, which is to be stored in SEXP; IDENTIFIERS is a NULL terminated list of C strings, which specifies the structure of the S-Expression. Example: If IDENTIFIERS is a list of pointers to the strings "foo" and "bar" and if DATA is a data set containing the values "val1 = 0x01" and "val2 = 0x02", then the resulting S-Expression will look like this: (foo (bar ((val1 0x01) (val2 0x02))). -- Function: gcry_error gcry_ac_data_from_sexp (gcry_ac_data_t *DATA, gcry_sexp_t SEXP, const char **IDENTIFIERS) This function converts the S-Expression SEXP into a newly created data set, which is to be stored in DATA; IDENTIFIERS is a NULL terminated list of C strings, which specifies the structure of the S-Expression. If the list of identifiers does not match the structure of the S-Expression, the function fails.  File: gcrypt.info, Node: Working with IO objects, Next: Working with handles, Prev: Working with sets of data, Up: AC Interface 6.6.3 Working with IO objects ----------------------------- Note: IO objects are currently only used in the context of message encoding/decoding and encryption/signature schemes. -- Data type: gcry_ac_io_t `gcry_ac_io_t' is the type to be used for IO objects. IO objects provide an uniform IO layer on top of different underlying IO mechanisms; either they can be used for providing data to the library (mode is GCRY_AC_IO_READABLE) or they can be used for retrieving data from the library (mode is GCRY_AC_IO_WRITABLE). IO object need to be initialized by calling on of the following functions: -- Function: void gcry_ac_io_init (gcry_ac_io_t *AC_IO, gcry_ac_io_mode_t MODE, gcry_ac_io_type_t TYPE, ...); Initialize AC_IO according to MODE, TYPE and the variable list of arguments. The list of variable arguments to specify depends on the given TYPE. -- Function: void gcry_ac_io_init_va (gcry_ac_io_t *AC_IO, gcry_ac_io_mode_t MODE, gcry_ac_io_type_t TYPE, va_list AP); Initialize AC_IO according to MODE, TYPE and the variable list of arguments AP. The list of variable arguments to specify depends on the given TYPE. The following types of IO objects exist: `GCRY_AC_IO_STRING' In case of GCRY_AC_IO_READABLE the IO object will provide data from a memory string. Arguments to specify at initialization time: `unsigned char *' Pointer to the beginning of the memory string `size_t' Size of the memory string In case of GCRY_AC_IO_WRITABLE the object will store retrieved data in a newly allocated memory string. Arguments to specify at initialization time: `unsigned char **' Pointer to address, at which the pointer to the newly created memory string is to be stored `size_t *' Pointer to address, at which the size of the newly created memory string is to be stored `GCRY_AC_IO_CALLBACK' In case of GCRY_AC_IO_READABLE the object will forward read requests to a provided callback function. Arguments to specify at initialization time: `gcry_ac_data_read_cb_t' Callback function to use `void *' Opaque argument to provide to the callback function In case of GCRY_AC_IO_WRITABLE the object will forward write requests to a provided callback function. Arguments to specify at initialization time: `gcry_ac_data_write_cb_t' Callback function to use `void *' Opaque argument to provide to the callback function  File: gcrypt.info, Node: Working with handles, Next: Working with keys, Prev: Working with IO objects, Up: AC Interface 6.6.4 Working with handles -------------------------- In order to use an algorithm, an according handle must be created. This is done using the following function: -- Function: gcry_error_t gcry_ac_open (gcry_ac_handle_t *HANDLE, int ALGORITHM, int FLAGS) Creates a new handle for the algorithm ALGORITHM and stores it in HANDLE. FLAGS is not used currently. ALGORITHM must be a valid algorithm ID, see *Note Available asymmetric algorithms::, for a list of supported algorithms and the according constants. Besides using the listed constants directly, the functions `gcry_pk_name_to_id' may be used to convert the textual name of an algorithm into the according numeric ID. -- Function: void gcry_ac_close (gcry_ac_handle_t HANDLE) Destroys the handle HANDLE.  File: gcrypt.info, Node: Working with keys, Next: Using cryptographic functions, Prev: Working with handles, Up: AC Interface 6.6.5 Working with keys ----------------------- -- Data type: gcry_ac_key_type_t Defined constants: `GCRY_AC_KEY_SECRET' Specifies a secret key. `GCRY_AC_KEY_PUBLIC' Specifies a public key. -- Data type: gcry_ac_key_t This type represents a single `key', either a secret one or a public one. -- Data type: gcry_ac_key_pair_t This type represents a `key pair' containing a secret and a public key. Key data structures can be created in two different ways; a new key pair can be generated, resulting in ready-to-use key. Alternatively a key can be initialized from a given data set. -- Function: gcry_error_t gcry_ac_key_init (gcry_ac_key_t *KEY, gcry_ac_handle_t HANDLE, gcry_ac_key_type_t TYPE, gcry_ac_data_t DATA) Creates a new key of type TYPE, consisting of the MPI values contained in the data set DATA and stores it in KEY. -- Function: gcry_error_t gcry_ac_key_pair_generate (gcry_ac_handle_t HANDLE, unsigned int NBITS, void *KEY_SPEC, gcry_ac_key_pair_t *KEY_PAIR, gcry_mpi_t **MISC_DATA) Generates a new key pair via the handle HANDLE of NBITS bits and stores it in KEY_PAIR. In case non-standard settings are wanted, a pointer to a structure of type `gcry_ac_key_spec__t', matching the selected algorithm, can be given as KEY_SPEC. MISC_DATA is not used yet. Such a structure does only exist for RSA. A description of the members of the supported structures follows. `gcry_ac_key_spec_rsa_t' `gcry_mpi_t e' Generate the key pair using a special `e'. The value of `e' has the following meanings: `= 0' Let Libgcrypt decide what exponent should be used. `= 1' Request the use of a "secure" exponent; this is required by some specification to be 65537. `> 2' Try starting at this value until a working exponent is found. Note that the current implementation leaks some information about the private key because the incrementation used is not randomized. Thus, this function will be changed in the future to return a random exponent of the given size. Example code: { gcry_ac_key_pair_t key_pair; gcry_ac_key_spec_rsa_t rsa_spec; rsa_spec.e = gcry_mpi_new (0); gcry_mpi_set_ui (rsa_spec.e, 1); err = gcry_ac_open (&handle, GCRY_AC_RSA, 0); assert (! err); err = gcry_ac_key_pair_generate (handle, 1024, &rsa_spec, &key_pair, NULL); assert (! err); } -- Function: gcry_ac_key_t gcry_ac_key_pair_extract (gcry_ac_key_pair_t KEY_PAIR, gcry_ac_key_type_t WHICH) Returns the key of type WHICH out of the key pair KEY_PAIR. -- Function: void gcry_ac_key_destroy (gcry_ac_key_t KEY) Destroys the key KEY. -- Function: void gcry_ac_key_pair_destroy (gcry_ac_key_pair_t KEY_PAIR) Destroys the key pair KEY_PAIR. -- Function: gcry_ac_data_t gcry_ac_key_data_get (gcry_ac_key_t KEY) Returns the data set contained in the key KEY. -- Function: gcry_error_t gcry_ac_key_test (gcry_ac_handle_t HANDLE, gcry_ac_key_t KEY) Verifies that the private key KEY is sane via HANDLE. -- Function: gcry_error_t gcry_ac_key_get_nbits (gcry_ac_handle_t HANDLE, gcry_ac_key_t KEY, unsigned int *NBITS) Stores the number of bits of the key KEY in NBITS via HANDLE. -- Function: gcry_error_t gcry_ac_key_get_grip (gcry_ac_handle_t HANDLE, gcry_ac_key_t KEY, unsigned char *KEY_GRIP) Writes the 20 byte long key grip of the key KEY to KEY_GRIP via HANDLE.  File: gcrypt.info, Node: Using cryptographic functions, Next: Handle-independent functions, Prev: Working with keys, Up: AC Interface 6.6.6 Using cryptographic functions ----------------------------------- The following flags might be relevant: `GCRY_AC_FLAG_NO_BLINDING' Disable any blinding, which might be supported by the chosen algorithm; blinding is the default. There exist two kinds of cryptographic functions available through the ac interface: primitives, and high-level functions. Primitives deal with MPIs (data sets) directly; what they provide is direct access to the cryptographic operations provided by an algorithm implementation. High-level functions deal with octet strings, according to a specified "scheme". Schemes make use of "encoding methods", which are responsible for converting the provided octet strings into MPIs, which are then forwared to the cryptographic primitives. Since schemes are to be used for a special purpose in order to achieve a particular security goal, there exist "encryption schemes" and "signature schemes". Encoding methods can be used seperately or implicitly through schemes. What follows is a description of the cryptographic primitives. -- Function: gcry_error_t gcry_ac_data_encrypt (gcry_ac_handle_t HANDLE, unsigned int FLAGS, gcry_ac_key_t KEY, gcry_mpi_t DATA_PLAIN, gcry_ac_data_t *DATA_ENCRYPTED) Encrypts the plain text MPI value DATA_PLAIN with the key public KEY under the control of the flags FLAGS and stores the resulting data set into DATA_ENCRYPTED. -- Function: gcry_error_t gcry_ac_data_decrypt (gcry_ac_handle_t HANDLE, unsigned int FLAGS, gcry_ac_key_t KEY, gcry_mpi_t *DATA_PLAIN, gcry_ac_data_t DATA_ENCRYPTED) Decrypts the encrypted data contained in the data set DATA_ENCRYPTED with the secret key KEY under the control of the flags FLAGS and stores the resulting plain text MPI value in DATA_PLAIN. -- Function: gcry_error_t gcry_ac_data_sign (gcry_ac_handle_t HANDLE, gcry_ac_key_t KEY, gcry_mpi_t DATA, gcry_ac_data_t *DATA_SIGNATURE) Signs the data contained in DATA with the secret key KEY and stores the resulting signature in the data set DATA_SIGNATURE. -- Function: gcry_error_t gcry_ac_data_verify (gcry_ac_handle_t HANDLE, gcry_ac_key_t KEY, gcry_mpi_t DATA, gcry_ac_data_t DATA_SIGNATURE) Verifies that the signature contained in the data set DATA_SIGNATURE is indeed the result of signing the data contained in DATA with the secret key belonging to the public key KEY. What follows is a description of the high-level functions. The type "gcry_ac_em_t" is used for specifying encoding methods; the following methods are supported: `GCRY_AC_EME_PKCS_V1_5' PKCS-V1_5 Encoding Method for Encryption. Options must be provided through a pointer to a correctly initialized object of type gcry_ac_eme_pkcs_v1_5_t. `GCRY_AC_EMSA_PKCS_V1_5' PKCS-V1_5 Encoding Method for Signatures with Appendix. Options must be provided through a pointer to a correctly initialized object of type gcry_ac_emsa_pkcs_v1_5_t. Option structure types: `gcry_ac_eme_pkcs_v1_5_t' `gcry_ac_key_t key' `gcry_ac_handle_t handle' `gcry_ac_emsa_pkcs_v1_5_t' `gcry_md_algo_t md' `size_t em_n' Encoding methods can be used directly through the following functions: -- Function: gcry_error_t gcry_ac_data_encode (gcry_ac_em_t METHOD, unsigned int FLAGS, void *OPTIONS, unsigned char *M, size_t M_N, unsigned char **EM, size_t *EM_N) Encodes the message contained in M of size M_N according to METHOD, FLAGS and OPTIONS. The newly created encoded message is stored in EM and EM_N. -- Function: gcry_error_t gcry_ac_data_decode (gcry_ac_em_t METHOD, unsigned int FLAGS, void *OPTIONS, unsigned char *EM, size_t EM_N, unsigned char **M, size_t *M_N) Decodes the message contained in EM of size EM_N according to METHOD, FLAGS and OPTIONS. The newly created decoded message is stored in M and M_N. The type "gcry_ac_scheme_t" is used for specifying schemes; the following schemes are supported: `GCRY_AC_ES_PKCS_V1_5' PKCS-V1_5 Encryption Scheme. No options can be provided. `GCRY_AC_SSA_PKCS_V1_5' PKCS-V1_5 Signature Scheme (with Appendix). Options can be provided through a pointer to a correctly initialized object of type gcry_ac_ssa_pkcs_v1_5_t. Option structure types: `gcry_ac_ssa_pkcs_v1_5_t' `gcry_md_algo_t md' The functions implementing schemes: -- Function: gcry_error_t gcry_ac_data_encrypt_scheme (gcry_ac_handle_t HANDLE, gcry_ac_scheme_t SCHEME, unsigned int FLAGS, void *OPTS, gcry_ac_key_t KEY, gcry_ac_io_t *IO_MESSAGE, gcry_ac_io_t *IO_CIPHER) Encrypts the plain text readable from IO_MESSAGE through HANDLE with the public key KEY according to SCHEME, FLAGS and OPTS. If OPTS is not NULL, it has to be a pointer to a structure specific to the chosen scheme (gcry_ac_es_*_t). The encrypted message is written to IO_CIPHER. -- Function: gcry_error_t gcry_ac_data_decrypt_scheme (gcry_ac_handle_t HANDLE, gcry_ac_scheme_t SCHEME, unsigned int FLAGS, void *OPTS, gcry_ac_key_t KEY, gcry_ac_io_t *IO_CIPHER, gcry_ac_io_t *IO_MESSAGE) Decrypts the cipher text readable from IO_CIPHER through HANDLE with the secret key KEY according to SCHEME, FLAGS and OPTS. If OPTS is not NULL, it has to be a pointer to a structure specific to the chosen scheme (gcry_ac_es_*_t). The decrypted message is written to IO_MESSAGE. -- Function: gcry_error_t gcry_ac_data_sign_scheme (gcry_ac_handle_t HANDLE, gcry_ac_scheme_t SCHEME, unsigned int FLAGS, void *OPTS, gcry_ac_key_t KEY, gcry_ac_io_t *IO_MESSAGE, gcry_ac_io_t *IO_SIGNATURE) Signs the message readable from IO_MESSAGE through HANDLE with the secret key KEY according to SCHEME, FLAGS and OPTS. If OPTS is not NULL, it has to be a pointer to a structure specific to the chosen scheme (gcry_ac_ssa_*_t). The signature is written to IO_SIGNATURE. -- Function: gcry_error_t gcry_ac_data_verify_scheme (gcry_ac_handle_t HANDLE, gcry_ac_scheme_t SCHEME, unsigned int FLAGS, void *OPTS, gcry_ac_key_t KEY, gcry_ac_io_t *IO_MESSAGE, gcry_ac_io_t *IO_SIGNATURE) Verifies through HANDLE that the signature readable from IO_SIGNATURE is indeed the result of signing the message readable from IO_MESSAGE with the secret key belonging to the public key KEY according to SCHEME and OPTS. If OPTS is not NULL, it has to be an anonymous structure (gcry_ac_ssa_*_t) specific to the chosen scheme.  File: gcrypt.info, Node: Handle-independent functions, Prev: Using cryptographic functions, Up: AC Interface 6.6.7 Handle-independent functions ---------------------------------- These two functions are deprecated; do not use them for new code. -- Function: gcry_error_t gcry_ac_id_to_name (gcry_ac_id_t ALGORITHM, const char **NAME) Stores the textual representation of the algorithm whose id is given in ALGORITHM in NAME. Deprecated; use `gcry_pk_algo_name'. -- Function: gcry_error_t gcry_ac_name_to_id (const char *NAME, gcry_ac_id_t *ALGORITHM) Stores the numeric ID of the algorithm whose textual representation is contained in NAME in ALGORITHM. Deprecated; use `gcry_pk_map_name'.  File: gcrypt.info, Node: Hashing, Next: Random Numbers, Prev: Public Key cryptography, Up: Top 7 Hashing ********* Libgcrypt provides an easy and consistent to use interface for hashing. Hashing is buffered and several hash algorithms can be updated at once. It is possible to compute a MAC using the same routines. The programming model follows an open/process/close paradigm and is in that similar to other building blocks provided by Libgcrypt. For convenience reasons, a few cyclic redundancy check value operations are also supported. * Menu: * Available hash algorithms:: List of hash algorithms supported by the library. * Hash algorithm modules:: How to work with hash algorithm modules. * Working with hash algorithms:: List of functions related to hashing.  File: gcrypt.info, Node: Available hash algorithms, Next: Hash algorithm modules, Up: Hashing 7.1 Available hash algorithms ============================= `GCRY_MD_NONE' This is not a real algorithm but used by some functions as an error return value. This constant is guaranteed to have the value `0'. `GCRY_MD_SHA1' This is the SHA-1 algorithm which yields a message digest of 20 bytes. `GCRY_MD_RMD160' This is the 160 bit version of the RIPE message digest (RIPE-MD-160). Like SHA-1 it also yields a digest of 20 bytes. `GCRY_MD_MD5' This is the well known MD5 algorithm, which yields a message digest of 16 bytes. `GCRY_MD_MD4' This is the MD4 algorithm, which yields a message digest of 16 bytes. `GCRY_MD_MD2' This is an reserved identifier for MD-2; there is no implementation yet. `GCRY_MD_TIGER' This is the TIGER/192 algorithm which yields a message digest of 24 bytes. `GCRY_MD_HAVAL' This is an reserved for the HAVAL algorithm with 5 passes and 160 bit. It yields a message digest of 20 bytes. Note that there is no implementation yet available. `GCRY_MD_SHA224' This is the SHA-224 algorithm which yields a message digest of 28 bytes. See Change Notice 1 for FIPS 180-2 for the specification. `GCRY_MD_SHA256' This is the SHA-256 algorithm which yields a message digest of 32 bytes. See FIPS 180-2 for the specification. `GCRY_MD_SHA384' This is the SHA-384 algorithm which yields a message digest of 48 bytes. See FIPS 180-2 for the specification. `GCRY_MD_SHA512' This is the SHA-384 algorithm which yields a message digest of 64 bytes. See FIPS 180-2 for the specification. `GCRY_MD_CRC32' This is the ISO 3309 and ITU-T V.42 cyclic redundancy check. It yields an output of 4 bytes. `GCRY_MD_CRC32_RFC1510' This is the above cyclic redundancy check function, as modified by RFC 1510. It yields an output of 4 bytes. `GCRY_MD_CRC24_RFC2440' This is the OpenPGP cyclic redundancy check function. It yields an output of 3 bytes. `GCRY_MD_WHIRLPOOL' This is the Whirlpool algorithm which yields a message digest of 64 bytes.  File: gcrypt.info, Node: Hash algorithm modules, Next: Working with hash algorithms, Prev: Available hash algorithms, Up: Hashing 7.2 Hash algorithm modules ========================== Libgcrypt makes it possible to load additional `message digest modules'; these digests can be used just like the message digest algorithms that are built into the library directly. For an introduction into extension modules, see *Note Modules::. -- Data type: gcry_md_spec_t This is the `module specification structure' needed for registering message digest modules, which has to be filled in by the user before it can be used to register a module. It contains the following members: `const char *name' The primary name of this algorithm. `unsigned char *asnoid' Array of bytes that form the ASN OID. `int asnlen' Length of bytes in `asnoid'. `gcry_md_oid_spec_t *oids' A list of OIDs that are to be associated with the algorithm. The list's last element must have it's `oid' member set to NULL. See below for an explanation of this type. See below for an explanation of this type. `int mdlen' Length of the message digest algorithm. See below for an explanation of this type. `gcry_md_init_t init' The function responsible for initializing a handle. See below for an explanation of this type. `gcry_md_write_t write' The function responsible for writing data into a message digest context. See below for an explanation of this type. `gcry_md_final_t final' The function responsible for `finalizing' a message digest context. See below for an explanation of this type. `gcry_md_read_t read' The function responsible for reading out a message digest result. See below for an explanation of this type. `size_t contextsize' The size of the algorithm-specific `context', that should be allocated for each handle. -- Data type: gcry_md_oid_spec_t This type is used for associating a user-provided algorithm implementation with certain OIDs. It contains the following members: `const char *oidstring' Textual representation of the OID. -- Data type: gcry_md_init_t Type for the `init' function, defined as: void (*gcry_md_init_t) (void *c) -- Data type: gcry_md_write_t Type for the `write' function, defined as: void (*gcry_md_write_t) (void *c, unsigned char *buf, size_t nbytes) -- Data type: gcry_md_final_t Type for the `final' function, defined as: void (*gcry_md_final_t) (void *c) -- Data type: gcry_md_read_t Type for the `read' function, defined as: unsigned char *(*gcry_md_read_t) (void *c) -- Function: gcry_error_t gcry_md_register (gcry_md_spec_t *DIGEST, unsigned int *algorithm_id, gcry_module_t *MODULE) Register a new digest module whose specification can be found in DIGEST. On success, a new algorithm ID is stored in ALGORITHM_ID and a pointer representing this module is stored in MODULE. -- Function: void gcry_md_unregister (gcry_module_t MODULE) Unregister the digest identified by MODULE, which must have been registered with gcry_md_register. -- Function: gcry_error_t gcry_md_list (int *LIST, int *LIST_LENGTH) Get a list consisting of the IDs of the loaded message digest modules. If LIST is zero, write the number of loaded message digest modules to LIST_LENGTH and return. If LIST is non-zero, the first *LIST_LENGTH algorithm IDs are stored in LIST, which must be of according size. In case there are less message digests modules than *LIST_LENGTH, *LIST_LENGTH is updated to the correct number.  File: gcrypt.info, Node: Working with hash algorithms, Prev: Hash algorithm modules, Up: Hashing 7.3 Working with hash algorithms ================================ To use most of these function it is necessary to create a context; this is done using: -- Function: gcry_error_t gcry_md_open (gcry_md_hd_t *HD, int ALGO, unsigned int FLAGS) Create a message digest object for algorithm ALGO. FLAGS may be given as an bitwise OR of constants described below. ALGO may be given as `0' if the algorithms to use are later set using `gcry_md_enable'. HD is guaranteed to either receive a valid handle or NULL. For a list of supported algorithms, see *Note Available hash algorithms::. The flags allowed for MODE are: `GCRY_MD_FLAG_SECURE' Allocate all buffers and the resulting digest in "secure memory". Use this is the hashed data is highly confidential. `GCRY_MD_FLAG_HMAC' Turn the algorithm into a HMAC message authentication algorithm. This only works if just one algorithm is enabled for the handle. Note that the function `gcry_md_setkey' must be used to set the MAC key. The size of the MAC is equal to the message digest of the underlying hash algorithm. If you want CBC message authentication codes based on a cipher, see *Note Working with cipher handles::. You may use the function `gcry_md_is_enabled' to later check whether an algorithm has been enabled. If you want to calculate several hash algorithms at the same time, you have to use the following function right after the `gcry_md_open': -- Function: gcry_error_t gcry_md_enable (gcry_md_hd_t H, int ALGO) Add the message digest algorithm ALGO to the digest object described by handle H. Duplicated enabling of algorithms is detected and ignored. If the flag `GCRY_MD_FLAG_HMAC' was used, the key for the MAC must be set using the function: -- Function: gcry_error_t gcry_md_setkey (gcry_md_hd_t H, const void *KEY, size_t KEYLEN) For use with the HMAC feature, set the MAC key to the value of KEY of length KEYLEN. There is no restriction on the length of the key. After you are done with the hash calculation, you should release the resources by using: -- Function: void gcry_md_close (gcry_md_hd_t H) Release all resources of hash context H. H should not be used after a call to this function. A `NULL' passed as H is ignored. Often you have to do several hash operations using the same algorithm. To avoid the overhead of creating and releasing context, a reset function is provided: -- Function: void gcry_md_reset (gcry_md_hd_t H) Reset the current context to its initial state. This is effectively identical to a close followed by an open and enabling all currently active algorithms. Often it is necessary to start hashing some data and then continue to hash different data. To avoid hashing the same data several times (which might not even be possible if the data is received from a pipe), a snapshot of the current hash context can be taken and turned into a new context: -- Function: gcry_error_t gcry_md_copy (gcry_md_hd_t *HANDLE_DST, gcry_md_hd_t HANDLE_SRC) Create a new digest object as an exact copy of the object described by handle HANDLE_SRC and store it in HANDLE_DST. The context is not reset and you can continue to hash data using this context and independently using the original context. Now that we have prepared everything to calculate hashes, it is time to see how it is actually done. There are two ways for this, one to update the hash with a block of memory and one macro to update the hash by just one character. Both methods can be used on the same hash context. -- Function: void gcry_md_write (gcry_md_hd_t H, const void *BUFFER, size_t LENGTH) Pass LENGTH bytes of the data in BUFFER to the digest object with handle H to update the digest values. This function should be used for large blocks of data. -- Function: void gcry_md_putc (gcry_md_hd_t H, int C) Pass the byte in C to the digest object with handle H to update the digest value. This is an efficient function, implemented as a macro to buffer the data before an actual update. The semantics of the hash functions do not provide for reading out intermediate message digests because the calculation must be finalized first. This finalization may for example include the number of bytes hashed in the message digest or some padding. -- Function: void gcry_md_final (gcry_md_hd_t H) Finalize the message digest calculation. This is not really needed because `gcry_md_read' does this implicitly. After this has been done no further updates (by means of `gcry_md_write' or `gcry_md_putc' are allowed. Only the first call to this function has an effect. It is implemented as a macro. The way to read out the calculated message digest is by using the function: -- Function: unsigned char * gcry_md_read (gcry_md_hd_t H, int ALGO) `gcry_md_read' returns the message digest after finalizing the calculation. This function may be used as often as required but it will always return the same value for one handle. The returned message digest is allocated within the message context and therefore valid until the handle is released or reseted (using `gcry_md_close' or `gcry_md_reset'. ALGO may be given as 0 to return the only enabled message digest or it may specify one of the enabled algorithms. The function does return `NULL' if the requested algorithm has not been enabled. Because it is often necessary to get the message digest of one block of memory, a fast convenience function is available for this task: -- Function: void gcry_md_hash_buffer (int ALGO, void *DIGEST, const void *BUFFER, size_t LENGTH); `gcry_md_hash_buffer' is a shortcut function to calculate a message digest of a buffer. This function does not require a context and immediately returns the message digest of the LENGTH bytes at BUFFER. DIGEST must be allocated by the caller, large enough to hold the message digest yielded by the the specified algorithm ALGO. This required size may be obtained by using the function `gcry_md_get_algo_dlen'. Note that this function will abort the process if an unavailable algorithm is used. Hash algorithms are identified by internal algorithm numbers (see `gcry_md_open' for a list). However, in most applications they are used by names, so two functions are available to map between string representations and hash algorithm identifiers. -- Function: const char * gcry_md_algo_name (int ALGO) Map the digest algorithm id ALGO to a string representation of the algorithm name. For unknown algorithms this function returns the string `"?"'. This function should not be used to test for the availability of an algorithm. -- Function: int gcry_md_map_name (const char *NAME) Map the algorithm with NAME to a digest algorithm identifier. Returns 0 if the algorithm name is not known. Names representing ASN.1 object identifiers are recognized if the IETF dotted format is used and the OID is prefixed with either "`oid.'" or "`OID.'". For a list of supported OIDs, see the source code at `cipher/md.c'. This function should not be used to test for the availability of an algorithm. -- Function: gcry_error_t gcry_md_get_asnoid (int ALGO, void *BUFFER, size_t *LENGTH) Return an DER encoded ASN.1 OID for the algorithm ALGO in the user allocated BUFFER. LENGTH must point to variable with the available size of BUFFER and receives after return the actual size of the returned OID. The returned error code may be `GPG_ERR_TOO_SHORT' if the provided buffer is to short to receive the OID; it is possible to call the function with `NULL' for BUFFER to have it only return the required size. The function returns 0 on success. To test whether an algorithm is actually available for use, the following macro should be used: -- Function: gcry_error_t gcry_md_test_algo (int ALGO) The macro returns 0 if the algorithm ALGO is available for use. If the length of a message digest is not known, it can be retrieved using the following function: -- Function: unsigned int gcry_md_get_algo_dlen (int ALGO) Retrieve the length in bytes of the digest yielded by algorithm ALGO. This is often used prior to `gcry_md_read' to allocate sufficient memory for the digest. In some situations it might be hard to remember the algorithm used for the ongoing hashing. The following function might be used to get that information: -- Function: int gcry_md_get_algo (gcry_md_hd_t H) Retrieve the algorithm used with the handle H. Note that this does not work reliable if more than one algorithm is enabled in H. The following macro might also be useful: -- Function: int gcry_md_is_secure (gcry_md_hd_t H) This function returns true when the digest object H is allocated in "secure memory"; i.e. H was created with the `GCRY_MD_FLAG_SECURE'. -- Function: int gcry_md_is_enabled (gcry_md_hd_t H, int ALGO) This function returns true when the algorithm ALGO has been enabled for the digest object H. Tracking bugs related to hashing is often a cumbersome task which requires to add a lot of printf statements into the code. Libgcrypt provides an easy way to avoid this. The actual data hashed can be written to files on request. -- Function: void gcry_md_debug (gcry_md_hd_t H, const char *SUFFIX) Enable debugging for the digest object with handle H. This creates create files named `dbgmd-.' while doing the actual hashing. SUFFIX is the string part in the filename. The number is a counter incremented for each new hashing. The data in the file is the raw data as passed to `gcry_md_write' or `gcry_md_putc'. If `NULL' is used for SUFFIX, the debugging is stopped and the file closed. This is only rarely required because `gcry_md_close' implicitly stops debugging. The following two deprecated macros are used for debugging by old code. They shopuld be replaced by `gcry_md_debug'. -- Function: void gcry_md_start_debug (gcry_md_hd_t H, const char *SUFFIX) Enable debugging for the digest object with handle H. This creates create files named `dbgmd-.' while doing the actual hashing. SUFFIX is the string part in the filename. The number is a counter incremented for each new hashing. The data in the file is the raw data as passed to `gcry_md_write' or `gcry_md_putc'. -- Function: void gcry_md_stop_debug (gcry_md_hd_t H, int RESERVED) Stop debugging on handle H. RESERVED should be specified as 0. This function is usually not required because `gcry_md_close' does implicitly stop debugging.  File: gcrypt.info, Node: Random Numbers, Next: S-expressions, Prev: Hashing, Up: Top 8 Random Numbers **************** * Menu: * Quality of random numbers:: Libgcrypt uses different quality levels. * Retrieving random numbers:: How to retrieve random numbers.  File: gcrypt.info, Node: Quality of random numbers, Next: Retrieving random numbers, Up: Random Numbers 8.1 Quality of random numbers ============================= Libgcypt offers random numbers of different quality levels: -- Data type: gcry_random_level_t The constants for the random quality levels are of this enum type. `GCRY_WEAK_RANDOM' For all functions, except for `gcry_mpi_randomize', this level maps to GCRY_STRONG_RANDOM. If you do not want this, consider using `gcry_create_nonce'. `GCRY_STRONG_RANDOM' Use this level for session keys and similar purposes. `GCRY_VERY_STRONG_RANDOM' Use this level for long term key material.  File: gcrypt.info, Node: Retrieving random numbers, Prev: Quality of random numbers, Up: Random Numbers 8.2 Retrieving random numbers ============================= -- Function: void gcry_randomize (unsigned char *BUFFER, size_t LENGTH, enum gcry_random_level LEVEL) Fill BUFFER with LENGTH random bytes using a random quality as defined by LEVEL. -- Function: void * gcry_random_bytes (size_t NBYTES, enum gcry_random_level LEVEL) Convenience function to allocate a memory block consisting of NBYTES fresh random bytes using a random quality as defined by LEVEL. -- Function: void * gcry_random_bytes_secure (size_t NBYTES, enum gcry_random_level LEVEL) Convenience function to allocate a memory block consisting of NBYTES fresh random bytes using a random quality as defined by LEVEL. This function differs from `gcry_random_bytes' in that the returned buffer is allocated in a "secure" area of the memory. -- Function: void gcry_create_nonce (unsigned char *BUFFER, size_t LENGTH) Fill BUFFER with LENGTH unpredictable bytes. This is commonly called a nonce and may also be used for initialization vectors and padding. This is an extra function nearly independent of the other random function for 3 reasons: It better protects the regular random generator's internal state, provides better performance and does not drain the precious entropy pool.  File: gcrypt.info, Node: S-expressions, Next: MPI library, Prev: Random Numbers, Up: Top 9 S-expressions *************** S-expressions are used by the public key functions to pass complex data structures around. These LISP like objects are used by some cryptographic protocols (cf. RFC-2692) and Libgcrypt provides functions to parse and construct them. For detailed information, see `Ron Rivest, code and description of S-expressions, `http://theory.lcs.mit.edu/~rivest/sexp.html''. * Menu: * Data types for S-expressions:: Data types related with S-expressions. * Working with S-expressions:: How to work with S-expressions.  File: gcrypt.info, Node: Data types for S-expressions, Next: Working with S-expressions, Up: S-expressions 9.1 Data types for S-expressions ================================ -- Data type: gcry_sexp_t The `gcry_sexp_t' type describes an object with the Libgcrypt internal representation of an S-expression.  File: gcrypt.info, Node: Working with S-expressions, Prev: Data types for S-expressions, Up: S-expressions 9.2 Working with S-expressions ============================== There are several functions to create an Libgcrypt S-expression object from its external representation or from a string template. There is also a function to convert the internal representation back into one of the external formats: -- Function: gcry_error_t gcry_sexp_new (gcry_sexp_t *R_SEXP, const void *BUFFER, size_t LENGTH, int AUTODETECT) This is the generic function to create an new S-expression object from its external representation in BUFFER of LENGTH bytes. On success the result is stored at the address given by R_SEXP. With AUTODETECT set to 0, the data in BUFFER is expected to be in canonized format, with AUTODETECT set to 1 the parses any of the defined external formats. If BUFFER does not hold a valid S-expression an error code is returned and R_SEXP set to `NULL'. Note that the caller is responsible for releasing the newly allocated S-expression using `gcry_sexp_release'. -- Function: gcry_error_t gcry_sexp_create (gcry_sexp_t *R_SEXP, void *BUFFER, size_t LENGTH, int AUTODETECT, void (*FREEFNC)(void*)) This function is identical to `gcry_sexp_new' but has an extra argument FREEFNC, which, when not set to `NULL', is expected to be a function to release the BUFFER; most likely the standard `free' function is used for this argument. This has the effect of transferring the ownership of BUFFER to the created object in R_SEXP. The advantage of using this function is that Libgcrypt might decide to directly use the provided buffer and thus avoid extra copying. -- Function: gcry_error_t gcry_sexp_sscan (gcry_sexp_t *R_SEXP, size_t *ERROFF, const char *BUFFER, size_t LENGTH) This is another variant of the above functions. It behaves nearly identical but provides an ERROFF argument which will receive the offset into the buffer where the parsing stopped on error. -- Function: gcry_error_t gcry_sexp_build (gcry_sexp_t *R_SEXP, size_t *ERROFF, const char *FORMAT, ...) This function creates an internal S-expression from the string template FORMAT and stores it at the address of R_SEXP. If there is a parsing error, the function returns an appropriate error code and stores the offset into FORMAT where the parsing stopped in ERROFF. The function supports a couple of printf-like formatting characters and expects arguments for some of these escape sequences right after FORMAT. The following format characters are defined: `%m' The next argument is expected to be of type `gcry_mpi_t' and a copy of its value is inserted into the resulting S-expression. `%s' The next argument is expected to be of type `char *' and that string is inserted into the resulting S-expression. `%d' The next argument is expected to be of type `int' and its value is inserted into the resulting S-expression. `%b' The next argument is expected to be of type `int' directly followed by an argument of type `char *'. This represents a buffer of given length to be inserted into the resulting regular expression. No other format characters are defined and would return an error. Note that the format character `%%' does not exists, because a percent sign is not a valid character in an S-expression. -- Function: void gcry_sexp_release (gcry_sexp_t SEXP) Release the S-expression object SEXP. The next 2 functions are used to convert the internal representation back into a regular external S-expression format and to show the structure for debugging. -- Function: size_t gcry_sexp_sprint (gcry_sexp_t SEXP, int MODE, char *BUFFER, size_t MAXLENGTH) Copies the S-expression object SEXP into BUFFER using the format specified in MODE. MAXLENGTH must be set to the allocated length of BUFFER. The function returns the actual length of valid bytes put into BUFFER or 0 if the provided buffer is too short. Passing `NULL' for BUFFER returns the required length for BUFFER. For convenience reasons an extra byte with value 0 is appended to the buffer. The following formats are supported: `GCRYSEXP_FMT_DEFAULT' Returns a convenient external S-expression representation. `GCRYSEXP_FMT_CANON' Return the S-expression in canonical format. `GCRYSEXP_FMT_BASE64' Not currently supported. `GCRYSEXP_FMT_ADVANCED' Returns the S-expression in advanced format. -- Function: void gcry_sexp_dump (gcry_sexp_t SEXP) Dumps SEXP in a format suitable for debugging to Libgcrypt's logging stream. Often canonical encoding is used in the external representation. The following function can be used to check for valid encoding and to learn the length of the S-expression" -- Function: size_t gcry_sexp_canon_len (const unsigned char *BUFFER, size_t LENGTH, size_t *ERROFF, int *ERRCODE) Scan the canonical encoded BUFFER with implicit length values and return the actual length this S-expression uses. For a valid S-expression it should never return 0. If LENGTH is not 0, the maximum length to scan is given; this can be used for syntax checks of data passed from outside. ERRCODE and ERROFF may both be passed as `NULL'. There are a couple of functions to parse S-expressions and retrieve elements: -- Function: gcry_sexp_t gcry_sexp_find_token (const gcry_sexp_t LIST, const char *TOKEN, size_t TOKLEN) Scan the S-expression for a sublist with a type (the car of the list) matching the string TOKEN. If TOKLEN is not 0, the token is assumed to be raw memory of this length. The function returns a newly allocated S-expression consisting of the found sublist or `NULL' when not found. -- Function: int gcry_sexp_length (const gcry_sexp_t LIST) Return the length of the LIST. For a valid S-expression this should be at least 1. -- Function: gcry_sexp_t gcry_sexp_nth (const gcry_sexp_t LIST, int NUMBER) Create and return a new S-expression from the element with index NUMBER in LIST. Note that the first element has the index 0. If there is no such element, `NULL' is returned. -- Function: gcry_sexp_t gcry_sexp_car (const gcry_sexp_t LIST) Create and return a new S-expression from the first element in LIST; this called the "type" and should always exist and be a string. `NULL' is returned in case of a problem. -- Function: gcry_sexp_t gcry_sexp_cdr (const gcry_sexp_t LIST) Create and return a new list form all elements except for the first one. Note that this function may return an invalid S-expression because it is not guaranteed, that the type exists and is a string. However, for parsing a complex S-expression it might be useful for intermediate lists. Returns `NULL' on error. -- Function: const char * gcry_sexp_nth_data (const gcry_sexp_t LIST, int NUMBER, size_t *DATALEN) This function is used to get data from a LIST. A pointer to the actual data with index NUMBER is returned and the length of this data will be stored to DATALEN. If there is no data at the given index or the index represents another list, `NULL' is returned. *Caution:* The returned pointer is valid as long as LIST is not modified or released. Here is an example on how to extract and print the surname (Meier) from the S-expression `(Name Otto Meier (address Burgplatz 3))': size_t len; const char *name; name = gcry_sexp_nth_data (list, 2, &len); printf ("my name is %.*s\n", (int)len, name); -- Function: char * gcry_sexp_nth_string (gcry_sexp_t LIST, int NUMBER) This function is used to get and convert data from a LIST. The data is assumed to be a Nul terminated string. The caller must release this returned value using `gcry_free'. If there is no data at the given index, the index represents a list or the value can't be converted to a string, `NULL' is returned. -- Function: gcry_mpi_t gcry_sexp_nth_mpi (gcry_sexp_t LIST, int NUMBER, int MPIFMT) This function is used to get and convert data from a LIST. This data is assumed to be an MPI stored in the format described by MPIFMT and returned as a standard Libgcrypt MPI. The caller must release this returned value using `gcry_mpi_release'. If there is no data at the given index, the index represents a list or the value can't be converted to an MPI, `NULL' is returned.  File: gcrypt.info, Node: MPI library, Next: Prime numbers, Prev: S-expressions, Up: Top 10 MPI library ************** * Menu: * Data types:: MPI related data types. * Basic functions:: First steps with MPI numbers. * MPI formats:: External representation of MPIs. * Calculations:: Performing MPI calculations. * Comparisons:: How to compare MPI values. * Bit manipulations:: How to access single bits of MPI values. * Miscellaneous:: Miscellaneous MPI functions. Public key cryptography is based on mathematics with large numbers. To implement the public key functions, a library for handling these large numbers is required. Because of the general usefulness of such a library, its interface is exposed by Libgcrypt. In the context of Libgcrypt and in most other applications, these large numbers are called MPIs (multi-precision-integers).  File: gcrypt.info, Node: Data types, Next: Basic functions, Up: MPI library 10.1 Data types =============== -- Data type: gcry_mpi_t This type represents an object to hold an MPI.  File: gcrypt.info, Node: Basic functions, Next: MPI formats, Prev: Data types, Up: MPI library 10.2 Basic functions ==================== To work with MPIs, storage must be allocated and released for the numbers. This can be done with one of these functions: -- Function: gcry_mpi_t gcry_mpi_new (unsigned int NBITS) Allocate a new MPI object, initialize it to 0 and initially allocate enough memory for a number of at least NBITS. This pre-allocation is only a small performance issue and not actually necessary because Libgcrypt automatically re-allocates the required memory. -- Function: gcry_mpi_t gcry_mpi_snew (unsigned int NBITS) This is identical to `gcry_mpi_new' but allocates the MPI in the so called "secure memory" which in turn will take care that all derived values will also be stored in this "secure memory". Use this for highly confidential data like private key parameters. -- Function: gcry_mpi_t gcry_mpi_copy (const gcry_mpi_t A) Create a new MPI as the exact copy of A. -- Function: void gcry_mpi_release (gcry_mpi_t A) Release the MPI A and free all associated resources. Passing `NULL' is allowed and ignored. When a MPI stored in the "secure memory" is released, that memory gets wiped out immediately. The simplest operations are used to assign a new value to an MPI: -- Function: gcry_mpi_t gcry_mpi_set (gcry_mpi_t W, const gcry_mpi_t U) Assign the value of U to W and return W. If `NULL' is passed for W, a new MPI is allocated, set to the value of U and returned. -- Function: gcry_mpi_t gcry_mpi_set_ui (gcry_mpi_t W, unsigned long U) Assign the value of U to W and return W. If `NULL' is passed for W, a new MPI is allocated, set to the value of U and returned. This function takes an `unsigned int' as type for U and thus it is only possible to set W to small values (usually up to the word size of the CPU). -- Function: void gcry_mpi_swap (gcry_mpi_t A, gcry_mpi_t B) Swap the values of A and B.  File: gcrypt.info, Node: MPI formats, Next: Calculations, Prev: Basic functions, Up: MPI library 10.3 MPI formats ================ The following functions are used to convert between an external representation of an MPI and the internal one of Libgcrypt. -- Function: gcry_error_t gcry_mpi_scan (gcry_mpi_t *R_MPI, enum gcry_mpi_format FORMAT, const unsigned char *BUFFER, size_t BUFLEN, size_t *NSCANNED) Convert the external representation of an integer stored in BUFFER with a length of BUFLEN into a newly created MPI returned which will be stored at the address of R_MPI. For certain formats the length argument is not required and should be passed as `0'. After a successful operation the variable NSCANNED receives the number of bytes actually scanned unless NSCANNED was given as `NULL'. FORMAT describes the format of the MPI as stored in BUFFER: `GCRYMPI_FMT_STD' 2-complement stored without a length header. `GCRYMPI_FMT_PGP' As used by OpenPGP (only defined as unsigned). This is basically `GCRYMPI_FMT_STD' with a 2 byte big endian length header. `GCRYMPI_FMT_SSH' As used in the Secure Shell protocol. This is `GCRYMPI_FMT_STD' with a 4 byte big endian header. `GCRYMPI_FMT_HEX' Stored as a C style string with each byte of the MPI encoded as 2 hex digits. When using this format, BUFLEN must be zero. `GCRYMPI_FMT_USG' Simple unsigned integer. Note that all of the above formats store the integer in big-endian format (MSB first). -- Function: gcry_error_t gcry_mpi_print (enum gcry_mpi_format FORMAT, unsigned char *BUFFER, size_t BUFLEN, size_t *NWRITTEN, const gcry_mpi_t A) Convert the MPI A into an external representation described by FORMAT (see above) and store it in the provided BUFFER which has a usable length of at least the BUFLEN bytes. If NWRITTEN is not NULL, it will receive the number of bytes actually stored in BUFFER after a successful operation. -- Function: gcry_error_t gcry_mpi_aprint (enum gcry_mpi_format FORMAT, unsigned char **BUFFER, size_t *NBYTES, const gcry_mpi_t A) Convert the MPI A into an external representation described by FORMAT (see above) and store it in a newly allocated buffer which address will be stored in the variable BUFFER points to. The number of bytes stored in this buffer will be stored in the variable NBYTES points to, unless NBYTES is `NULL'. -- Function: void gcry_mpi_dump (const gcry_mpi_t A) Dump the value of A in a format suitable for debugging to Libgcrypt's logging stream. Note that one leading space but no trailing space or linefeed will be printed. It is okay to pass `NULL' for A.  File: gcrypt.info, Node: Calculations, Next: Comparisons, Prev: MPI formats, Up: MPI library 10.4 Calculations ================= Basic arithmetic operations: -- Function: void gcry_mpi_add (gcry_mpi_t W, gcry_mpi_t U, gcry_mpi_t V) W = U + V. -- Function: void gcry_mpi_add_ui (gcry_mpi_t W, gcry_mpi_t U, unsigned long V) W = U + V. Note that V is an unsigned integer. -- Function: void gcry_mpi_addm (gcry_mpi_t W, gcry_mpi_t U, gcry_mpi_t V, gcry_mpi_t M) W = U + V \bmod M. -- Function: void gcry_mpi_sub (gcry_mpi_t W, gcry_mpi_t U, gcry_mpi_t V) W = U - V. -- Function: void gcry_mpi_sub_ui (gcry_mpi_t W, gcry_mpi_t U, unsigned long V) W = U - V. V is an unsigned integer. -- Function: void gcry_mpi_subm (gcry_mpi_t W, gcry_mpi_t U, gcry_mpi_t V, gcry_mpi_t M) W = U - V \bmod M. -- Function: void gcry_mpi_mul (gcry_mpi_t W, gcry_mpi_t U, gcry_mpi_t V) W = U * V. -- Function: void gcry_mpi_mul_ui (gcry_mpi_t W, gcry_mpi_t U, unsigned long V) W = U * V. V is an unsigned integer. -- Function: void gcry_mpi_mulm (gcry_mpi_t W, gcry_mpi_t U, gcry_mpi_t V, gcry_mpi_t M) W = U * V \bmod M. -- Function: void gcry_mpi_mul_2exp (gcry_mpi_t W, gcry_mpi_t U, unsigned long E) W = U * 2^e. -- Function: void gcry_mpi_div (gcry_mpi_t Q, gcry_mpi_t R, gcry_mpi_t DIVIDEND, gcry_mpi_t DIVISOR, int ROUND) Q = DIVIDEND / DIVISOR, R = DIVIDEND \bmod DIVISOR. Q and R may be passed as `NULL'. ROUND should be negative or 0. -- Function: void gcry_mpi_mod (gcry_mpi_t R, gcry_mpi_t DIVIDEND, gcry_mpi_t DIVISOR) R = DIVIDEND \bmod DIVISOR. -- Function: void gcry_mpi_powm (gcry_mpi_t W, const gcry_mpi_t B, const gcry_mpi_t E, const gcry_mpi_t M) W = B^e \bmod M. -- Function: int gcry_mpi_gcd (gcry_mpi_t G, gcry_mpi_t A, gcry_mpi_t B) Set G to the greatest common divisor of A and B. Return true if the G is 1. -- Function: int gcry_mpi_invm (gcry_mpi_t X, gcry_mpi_t A, gcry_mpi_t M) Set X to the multiplicative inverse of A \bmod M. Return true if the inverse exists.  File: gcrypt.info, Node: Comparisons, Next: Bit manipulations, Prev: Calculations, Up: MPI library 10.5 Comparisons ================ The next 2 functions are used to compare MPIs: -- Function: int gcry_mpi_cmp (const gcry_mpi_t U, const gcry_mpi_t V) Compare the multi-precision-integers number U and V returning 0 for equality, a positive value for U > V and a negative for U < V. -- Function: int gcry_mpi_cmp_ui (const gcry_mpi_t U, unsigned long V) Compare the multi-precision-integers number U with the unsigned integer V returning 0 for equality, a positive value for U > V and a negative for U < V.  File: gcrypt.info, Node: Bit manipulations, Next: Miscellaneous, Prev: Comparisons, Up: MPI library 10.6 Bit manipulations ====================== There are a couple of functions to get information on arbitrary bits in an MPI and to set or clear them: -- Function: unsigned int gcry_mpi_get_nbits (gcry_mpi_t A) Return the number of bits required to represent A. -- Function: int gcry_mpi_test_bit (gcry_mpi_t A, unsigned int N) Return true if bit number N (counting from 0) is set in A. -- Function: void gcry_mpi_set_bit (gcry_mpi_t A, unsigned int N) Set bit number N in A. -- Function: void gcry_mpi_clear_bit (gcry_mpi_t A, unsigned int N) Clear bit number N in A. -- Function: void gcry_mpi_set_highbit (gcry_mpi_t A, unsigned int N) Set bit number N in A and clear all bits greater than N. -- Function: void gcry_mpi_clear_highbit (gcry_mpi_t A, unsigned int N) Clear bit number N in A and all bits greater than N. -- Function: void gcry_mpi_rshift (gcry_mpi_t X, gcry_mpi_t A, unsigned int N) Shift the value of A by N bits to the right and store the result in X. -- Function: void gcry_mpi_lshift (gcry_mpi_t X, gcry_mpi_t A, unsigned int N) Shift the value of A by N bits to the left and store the result in X.  File: gcrypt.info, Node: Miscellaneous, Prev: Bit manipulations, Up: MPI library 10.7 Miscellaneous ================== -- Function: gcry_mpi_t gcry_mpi_set_opaque (gcry_mpi_t A, void *P, unsigned int NBITS) Store NBITS of the value P points to in A and mark A as an opaque value (i.e. an value that can't be used for any math calculation and is only used to store an arbitrary bit pattern in A). WARNING: Never use an opaque MPI for actual math operations. The only valid functions are gcry_mpi_get_opaque and gcry_mpi_release. Use gcry_mpi_scan to convert a string of arbitrary bytes into an MPI. -- Function: void * gcry_mpi_get_opaque (gcry_mpi_t A, unsigned int *NBITS) Return a pointer to an opaque value stored in A and return its size in NBITS. Note that the returned pointer is still owned by A and that the function should never be used for an non-opaque MPI. -- Function: void gcry_mpi_set_flag (gcry_mpi_t A, enum gcry_mpi_flag FLAG) Set the FLAG for the MPI A. Currently only the flag `GCRYMPI_FLAG_SECURE' is allowed to convert A into an MPI stored in "secure memory". -- Function: void gcry_mpi_clear_flag (gcry_mpi_t A, enum gcry_mpi_flag FLAG) Clear FLAG for the multi-precision-integers A. Note that this function is currently useless as no flags are allowed. -- Function: int gcry_mpi_get_flag (gcry_mpi_t A, enum gcry_mpi_flag FLAG) Return true when the FLAG is set for A. -- Function: void gcry_mpi_randomize (gcry_mpi_t W, unsigned int NBITS, enum gcry_random_level LEVEL) Set the multi-precision-integers W to a random value of NBITS, using random data quality of level LEVEL. In case NBITS is not a multiple of a byte, NBITS is rounded up to the next byte boundary. When using a LEVEL of `GCRY_WEAK_RANDOM' this function makes use of `gcry_create_nonce'.  File: gcrypt.info, Node: Prime numbers, Next: Utilities, Prev: MPI library, Up: Top 11 Prime numbers **************** * Menu: * Generation:: Generation of new prime numbers. * Checking:: Checking if a given number is prime.  File: gcrypt.info, Node: Generation, Next: Checking, Up: Prime numbers 11.1 Generation =============== -- Function: gcry_error_t gcry_prime_generate (gcry_mpi_t *PRIME,unsigned int PRIME_BITS, unsigned int FACTOR_BITS, gcry_mpi_t **FACTORS, gcry_prime_check_func_t CB_FUNC, void *CB_ARG, gcry_random_level_t RANDOM_LEVEL, unsigned int FLAGS) Generate a new prime number of PRIME_BITS bits and store it in PRIME. If FACTOR_BITS is non-zero, one of the prime factors of (PRIME - 1) / 2 must be FACTOR_BITS bits long. If FACTORS is non-zero, allocate a new, `NULL'-terminated array holding the prime factors and store it in FACTORS. FLAGS might be used to influence the prime number generation process. -- Function: gcry_error_t gcry_prime_group_generator (gcry_mpi_t *R_G, gcry_mpi_t PRIME, gcry_mpi_t *FACTORS, gcry_mpi_t START_G) Find a generator for PRIME where the factorization of (PRIME-1) is in the `NULL' terminated array FACTORS. Return the generator as a newly allocated MPI in R_G. If START_G is not NULL, use this as the start for the search. -- Function: void gcry_prime_release_factors (gcry_mpi_t *FACTORS) Convenience function to release the FACTORS array.  File: gcrypt.info, Node: Checking, Prev: Generation, Up: Prime numbers 11.2 Checking ============= -- Function: gcry_error_t gcry_prime_check (gcry_mpi_t P, unsigned int FLAGS) Check wether the number P is prime. Returns zero in case P is indeed a prime, returns `GPG_ERR_NO_PRIME' in case P is not a prime and a different error code in case something went horribly wrong.  File: gcrypt.info, Node: Utilities, Next: Architecture, Prev: Prime numbers, Up: Top 12 Utilities ************ * Menu: * Memory allocation:: Functions related with memory allocation.  File: gcrypt.info, Node: Memory allocation, Up: Utilities 12.1 Memory allocation ====================== -- Function: void * gcry_malloc (size_t N) This function tries to allocate N bytes of memory. On success it returns a pointer to the memory area, in an out-of-core condition, it returns NULL. -- Function: void * gcry_malloc_secure (size_t N) Like `gcry_malloc', but uses secure memory. -- Function: void * gcry_calloc (size_t N) This function tries to allocate N bytes of cleared memory (i.e. memory that is initialized with zero bytes). On success it returns a pointer to the memory area, in an out-of-core condition, it returns NULL. -- Function: void * gcry_calloc_secure (size_t N) Like `gcry_calloc', but uses secure memory. -- Function: void * gcry_realloc (void *P, size_t N) This function tries to resize the memory area pointed to by P to N bytes. On success it returns a pointer to the new memory area, in an out-of-core condition, it returns NULL. Depending on whether the memory pointed to by P is secure memory or not, gcry_realloc tries to use secure memory as well. -- Function: void gcry_free (void *P) Release the memory area pointed to by P.  File: gcrypt.info, Node: Architecture, Next: Self-Tests, Prev: Utilities, Up: Top 13 Architecture *************** This chapter describes the internal architecture of Libgcrypt. Libgcrypt is a function library written in ISO C-90. Any compliant compiler should be able to build Libgcrypt as long as the target is either a POSIX platform or compatible to the API used by Windows NT. Provisions have been take so that the library can be directly used from C++ applications; however building with a C++ compiler is not supported. Building Libgcrypt is done by using the common `./configure && make' approach. The configure command is included in the source distribution and as a portable shell script it works on any Unix-alike system. The result of running the configure script are a C header file (`config.h'), customized Makefiles, the setup of symbolic links and a few other things. After that the make tool builds and optionally installs the library and the documentation. See the files `INSTALL' and `README' in the source distribution on how to do this. Libgcrypt is developed using a Subversion(1) repository. Although all released versions are tagged in this repository, they should not be used to build production versions of Libgcrypt. Instead released tarballs should be used. These tarballs are available from several places with the master copy at . Announcements of new releases are posted to the mailing list(2). [image src="libgcrypt-modules.png" alt="Libgcrypt subsystems"] Figure 13.1: Libgcrypt subsystems Libgcrypt consists of several subsystems (*note Figure 13.1: fig:subsystems.) and all these subsystems provide a public API; this includes the helper subsystems like the one for S-expressions. The API style depends on the subsystem; in general an open-use-close approach is implemented. The open returns a handle to a context used for all further operations on this handle, several functions may then be used on this handle and a final close function releases all resources associated with the handle. * Menu: * Public-Key Subsystem Architecture:: About public keys. * Symmetric Encryption Subsystem Architecture:: About standard ciphers. * Hashing and MACing Subsystem Architecture:: About hashing. * Multi-Precision-Integer Subsystem Architecture:: About big integers. * Prime-Number-Generator Subsystem Architecture:: About prime numbers. * Random-Number Subsystem Architecture:: About random stuff. ---------- Footnotes ---------- (1) A version control system available for many platforms (2) See `http://www.gnupg.org/documentation/mailing-lists.en.html' for details.  File: gcrypt.info, Node: Public-Key Subsystem Architecture, Next: Symmetric Encryption Subsystem Architecture, Up: Architecture 13.1 Public-Key Architecture ============================ Libgcrypt implements two interfaces for public key cryptography: The standard interface is PK interface using functions in the `gcry_pk_' name space. The AC interface in an alternative one which is now deprecated and will not be further described. The AC interface is also disabled in FIPS mode. Because public key cryptography is almost always used to process small amounts of data (hash values or session keys), the interface is not implemented using the open-use-close paradigm, but with single self-contained functions. Due to the wide variety of parameters required by different algorithms S-expressions, as flexible way to convey these parameters, are used. There is a set of helper functions to work with these S-expressions. Aside of functions to register new algorithms, map algorithms names to algorithms identifiers and to lookup properties of a key, the following main functions are available: `gcry_pk_encrypt' Encrypt data using a public key. `gcry_pk_decrypt' Decrypt data using a private key. `gcry_pk_sign' Sign data using a private key. `gcry_pk_verify' Verify that a signature matches the data. `gcry_pk_testkey' Perform a consistency over a public or private key. `gcry_pk_genkey' Create a new public/private key pair. With the help of the module registration system all these functions lookup the module implementing the algorithm and pass the actual work to that module. The parsing of the S-expression input and the construction of S-expression for the return values is done by the high level code (`cipher/pubkey.c'). Thus the internal interface between the algorithm modules and the high level functions passes data in a custom format. The interface to the modules is published (`gcrypt-modules.h') so that it can used to register external implementations of algorithms with Libgcrypt. However, for some algorithms this module interface is to limited and thus for the internal modules an extra interface is sometimes used to convey more information. By default Libgcrypt uses a blinding technique for RSA decryption to mitigate real world timing attacks over a network: Instead of using the RSA decryption directly, a blinded value y = x r^e \bmod n is decrypted and the unblinded value x' = y' r^-1 \bmod n returned. The blinding value r is a random value with the size of the modulus n and generated with `GCRY_WEAK_RANDOM' random level. The algorithm used for RSA and DSA key generation depends on whether Libgcrypt is operated in standard or in FIPS mode. In standard mode an algorithm based on the Lim-Lee prime number generator is used. In FIPS mode RSA keys are generated as specified in ANSI X9.31 (1998) and DSA keys as specified in FIPS 186-2.  File: gcrypt.info, Node: Symmetric Encryption Subsystem Architecture, Next: Hashing and MACing Subsystem Architecture, Prev: Public-Key Subsystem Architecture, Up: Architecture 13.2 Symmetric Encryption Subsystem Architecture ================================================ The interface to work with symmetric encryption algorithms is made up of functions from the `gcry_cipher_' name space. The implementation follows the open-use-close paradigm and uses registered algorithm modules for the actual work. Unless a module implements optimized cipher mode implementations, the high level code (`cipher/cipher.c') implements the modes and calls the core algorithm functions to process each block. The most important functions are: `gcry_cipher_open' Create a new instance to encrypt or decrypt using a specified algorithm and mode. `gcry_cipher_close' Release an instance. `gcry_cipher_setkey' Set a key to be used for encryption or decryption. `gcry_cipher_setiv' Set an initialization vector to be used for encryption or decryption. `gcry_cipher_encrypt' `gcry_cipher_decrypt' Encrypt or decrypt data. These functions may be called with arbitrary amounts of data and as often as needed to encrypt or decrypt all data. There are also functions to query properties of algorithms or context, like block length, key length, map names or to enable features like padding methods.  File: gcrypt.info, Node: Hashing and MACing Subsystem Architecture, Next: Multi-Precision-Integer Subsystem Architecture, Prev: Symmetric Encryption Subsystem Architecture, Up: Architecture 13.3 Hashing and MACing Subsystem Architecture ============================================== The interface to work with message digests and CRC algorithms is made up of functions from the `gcry_md_' name space. The implementation follows the open-use-close paradigm and uses registered algorithm modules for the actual work. Although CRC algorithms are not considered cryptographic hash algorithms, they share enough properties so that it makes sense to handle them in the same way. It is possible to use several algorithms at once with one context and thus compute them all on the same data. The most important functions are: `gcry_md_open' Create a new message digest instance and optionally enable one algorithm. A flag may be used to turn the message digest algorithm into a HMAC algorithm. `gcry_md_enable' Enable an additional algorithm for the instance. `gcry_md_setkey' Set the key for the MAC. `gcry_md_write' Pass more data for computing the message digest to an instance. `gcry_md_putc' Buffered version of `gcry_md_write' implemented as a macro. `gcry_md_read' Finalize the computation of the message digest or HMAC and return the result. `gcry_md_close' Release an instance `gcry_md_hash_buffer' Convenience function to directly compute a message digest over a memory buffer without the need to create an instance first. There are also functions to query properties of algorithms or the instance, like enabled algorithms, digest length, map algorithm names. it is also possible to reset an instance or to copy the current state of an instance at any time. Debug functions to write the hashed data to files are available as well.  File: gcrypt.info, Node: Multi-Precision-Integer Subsystem Architecture, Next: Prime-Number-Generator Subsystem Architecture, Prev: Hashing and MACing Subsystem Architecture, Up: Architecture 13.4 Multi-Precision-Integer Subsystem Architecture =================================================== The implementation of Libgcrypt's big integer computation code is based on an old release of GNU Multi-Precision Library (GMP). The decision not to use the GMP library directly was due to stalled development at that time and due to security requirements which could not be provided by the code in GMP. As GMP does, Libgcrypt provides high performance assembler implementations of low level code for several CPUS to gain much better performance than with a generic C implementation. Major features of Libgcrypt's multi-precision-integer code compared to GMP are: * Avoidance of stack based allocations to allow protection against swapping out of sensitive data and for easy zeroing of sensitive intermediate results. * Optional use of secure memory and tracking of its use so that results are also put into secure memory. * MPIs are identified by a handle (implemented as a pointer) to give better control over allocations and to augment them with extra properties like opaque data. * Removal of unnecessary code to reduce complexity. * Functions specialized for public key cryptography.  File: gcrypt.info, Node: Prime-Number-Generator Subsystem Architecture, Next: Random-Number Subsystem Architecture, Prev: Multi-Precision-Integer Subsystem Architecture, Up: Architecture 13.5 Prime-Number-Generator Subsystem Architecture ================================================== Libgcrypt provides an interface to its prime number generator. These functions make use of the internal prime number generator which is required for the generation for public key key pairs. The plain prime checking function is exported as well. The generation of random prime numbers is based on the Lim and Lee algorithm to create practically save primes.(1) This algorithm creates a pool of smaller primes, select a few of them to create candidate primes of the form 2 * p_0 * p_1 * ... * p_n + 1, tests the candidate for primality and permutates the pool until a prime has been found. It is possible to clamp one of the small primes to a certain size to help DSA style algorithms. Because most of the small primes in the pool are not used for the resulting prime number, they are saved for later use (see `save_pool_prime' and `get_pool_prime' in `cipher/primegen.c'). The prime generator optionally supports the finding of an appropriate generator. The primality test works in three steps: 1. The standard sieve algorithm using the primes up to 4999 is used as a quick first check. 2. A Fermat test filters out almost all non-primes. 3. A 5 round Rabin-Miller test is finally used. The first round uses a witness of 2, whereas the next rounds use a random witness. To support the generation of RSA and DSA keys in FIPS mode according to X9.31 and FIPS 186-2, Libgcrypt implements two additional prime generation functions: `_gcry_derive_x931_prime' and `_gcry_generate_fips186_2_prime'. These functions are internal and not available through the public API. ---------- Footnotes ---------- (1) Chae Hoon Lim and Pil Joong Lee. A key recovery attack on discrete log-based shemes using a prime order subgroup. In Burton S. Kaliski Jr., editor, Advances in Cryptology: Crypto '97, pages 249­-263, Berlin / Heidelberg / New York, 1997. Springer-Verlag. Described on page 260.  File: gcrypt.info, Node: Random-Number Subsystem Architecture, Prev: Prime-Number-Generator Subsystem Architecture, Up: Architecture 13.6 Random-Number Subsystem Architecture ========================================= Libgcrypt provides 3 levels or random quality: The level `GCRY_VERY_STRONG_RANDOM' usually used for key generation, the level `GCRY_STRONG_RANDOM' for all other strong random requirements and the function `gcry_create_nonce' which is used for weaker usages like nonces. There is also a level `GCRY_WEAK_RANDOM' which in general maps to `GCRY_STRONG_RANDOM' except when used with the function `gcry_mpi_randomize', where it randomizes an multi-precision-integer using the `gcry_create_nonce' function. There are two distinct random generators available: * The Continuously Seeded Pseudo Random Number Generator (CSPRNG), which is based on the classic GnuPG derived big pool implementation. Implemented in `random/random-csprng.c' and used by default. * A FIPS approved ANSI X9.31 PRNG using AES with a 128 bit key. Implemented in `random/random-fips.c' and used if Libgcrypt is in FIPS mode. Both generators make use of so-called entropy gathering modules: rndlinux Uses the operating system provided `/dev/random' and `/dev/urandom' devices. rndunix Runs several operating system commands to collect entropy from sources like virtual machine and process statistics. It is a kind of poor-man's `/dev/random' implementation. It is not available in FIPS mode. rndegd Uses the operating system provided Entropy Gathering Daemon (EGD). The EGD basically uses the same algorithms as rndunix does. However as a system daemon it keeps on running and thus can serve several processes requiring entropy input and does not waste collected entropy if the application does not need all the collected entropy. It is not available in FIPS mode. rndw32 Targeted for the Microsoft Windows OS. It uses certain properties of that system and is the only gathering module available for that OS. rndhw Extra module to collect additional entropy by utilizing a hardware random number generator. As of now the only supported hardware RNG is the Padlock engine of VIA (Centaur) CPUs. It is not available in FIPS mode. * Menu: * CSPRNG Description:: Description of the CSPRNG. * FIPS PRNG Description:: Description of the FIPS X9.31 PRNG.  File: gcrypt.info, Node: CSPRNG Description, Next: FIPS PRNG Description, Up: Random-Number Subsystem Architecture 13.6.1 Description of the CSPRNG -------------------------------- This random number generator is loosely modelled after the one described in Peter Gutmann's paper: "Software Generation of Practically Strong Random Numbers".(1) A pool of 600 bytes is used and mixed using the core RIPE-MD160 hash transform function. Several extra features are used to make the robust against a wide variety of attacks and to protect against failures of subsystems. The state of the generator may be saved to a file and initially seed form a file. Depending on how Libgcrypt was build the generator is able to select the best working entropy gathering module. It makes use of the slow and fast collection methods and requires the pool to initially seeded form the slow gatherer or a seed file. An entropy estimation is used to mix in enough data from the gather modules before returning the actual random output. Process fork detection and protection is implemented. The implementation of the nonce generator (for `gcry_create_nonce') is a straightforward repeated hash design: A 28 byte buffer is initially seeded with the PID and the time in seconds in the first 20 bytes and with 8 bytes of random taken from the `GCRY_STRONG_RANDOM' generator. Random numbers are then created by hashing all the 28 bytes with SHA-1 and saving that again in the first 20 bytes. The hash is also returned as result. ---------- Footnotes ---------- (1) Also described in chapter 6 of his book "Cryptographic Security Architecture", New York, 2004, ISBN 0-387-95387-6.  File: gcrypt.info, Node: FIPS PRNG Description, Prev: CSPRNG Description, Up: Random-Number Subsystem Architecture 13.6.2 Description of the FIPS X9.31 PRNG ----------------------------------------- The core of this deterministic random number generator is implemented according to the document "NIST-Recommended Random Number Generator Based on ANSI X9.31 Appendix A.2.4 Using the 3-Key Triple DES and AES Algorithms", dated 2005-01-31. This implementation uses the AES variant. The generator is based on contexts to utilize the same core functions for all random levels as required by the high-level interface. All random generators return their data in 128 bit blocks. If the caller requests less bits, the extra bits are not used. The key for each generator is only set once at the first time a generator context is used. The seed value is set along with the key and again after 1000 output blocks. On Unix like systems the `GCRY_VERY_STRONG_RANDOM' and `GCRY_STRONG_RANDOM' generators are keyed and seeded using the rndlinux module with the `/dev/radnom' device. Thus these generators may block until the OS kernel has collected enough entropy. When used with Microsoft Windows the rndw32 module is used instead. The generator used for `gcry_create_nonce' is keyed and seeded from the `GCRY_STRONG_RANDOM' generator. Thus is may also block if the `GCRY_STRONG_RANDOM' generator has not yet been used before and thus gets initialized on the first use by `gcry_create_nonce'. This special treatment is justified by the weaker requirements for a nonce generator and to save precious kernel entropy for use by the "real" random generators. A self-test facility uses a separate context to check the functionality of the core X9.31 functions using a known answers test. During runtime each output block is compared to the previous one to detect a stucked generator. The DT value for the generator is made up of the current time down to microseconds (if available) and a free running 64 bit counter. When used with the test context the DT value is taken from the context and incremented on each use.  File: gcrypt.info, Node: Self-Tests, Next: FIPS Mode, Prev: Architecture, Up: Top Appendix A Description of the Self-Tests **************************************** In addition to the build time regression test suite, Libgcrypt implements self-tests to be performed at runtime. Which self-tests are actually used depends on the mode Libgcrypt is used in. In standard mode a limited set of self-tests is run at the time an algorithm is first used. Note that not all algorithms feature a self-test in standard mode. The `GCRYCTL_SELFTEST' control command may be used to run all implemented self-tests at any time; this will even run more tests than those run in FIPS mode. If any of the self-tests fails, the library immediately returns an error code to the caller. If Libgcrypt is in FIPS mode the self-tests will be performed within the "Self-Test" state and any failure puts the library into the "Error" state. A.1 Power-Up Tests ================== Power-up tests are only performed if Libgcrypt is in FIPS mode. A.1.1 Symmetric Cipher Algorithm Power-Up Tests ----------------------------------------------- The following symmetric encryption algorithm tests are run during power-up: 3DES To test the 3DES 3-key EDE encryption in ECB mode these tests are run: 1. A known answer test is run on a 64 bit test vector processed by 64 rounds of Single-DES block encryption and decryption using a key changed with each round. 2. A known answer test is run on a 64 bit test vector processed by 16 rounds of 2-key and 3-key Triple-DES block encryption and decryptions using a key changed with each round. 3. 10 known answer tests using 3-key Triple-DES EDE encryption, comparing the ciphertext to the known value, then running a decryption and comparing it to the initial plaintext. (`cipher/des.c:selftest') AES-128 A known answer tests is run using one test vector and one test key with AES in ECB mode. (`cipher/rijndael.c:selftest_basic_128') AES-192 A known answer tests is run using one test vector and one test key with AES in ECB mode. (`cipher/rijndael.c:selftest_basic_192') AES-256 A known answer tests is run using one test vector and one test key with AES in ECB mode. (`cipher/rijndael.c:selftest_basic_256') A.1.2 Hash Algorithm Power-Up Tests ----------------------------------- The following hash algorithm tests are run during power-up: SHA-1 A known answer test using the string `"abc"' is run. (`cipher/sha1.c:selftests_sha1') SHA-224 A known answer test using the string `"abc"' is run. (`cipher/sha256.c:selftests_sha224') SHA-256 A known answer test using the string `"abc"' is run. (`cipher/sha256.c:selftests_sha256') SHA-384 A known answer test using the string `"abc"' is run. (`cipher/sha512.c:selftests_sha384') SHA-512 A known answer test using the string `"abc"' is run. (`cipher/sha512.c:selftests_sha512') A.1.3 MAC Algorithm Power-Up Tests ---------------------------------- The following MAC algorithm tests are run during power-up: HMAC SHA-1 A known answer test using 9 byte of data and a 64 byte key is run. (`cipher/hmac-tests.c:selftests_sha1') HMAC SHA-224 A known answer test using 28 byte of data and a 4 byte key is run. (`cipher/hmac-tests.c:selftests_sha224') HMAC SHA-256 A known answer test using 28 byte of data and a 4 byte key is run. (`cipher/hmac-tests.c:selftests_sha256') HMAC SHA-384 A known answer test using 28 byte of data and a 4 byte key is run. (`cipher/hmac-tests.c:selftests_sha384') HMAC SHA-512 A known answer test using 28 byte of data and a 4 byte key is run. (`cipher/hmac-tests.c:selftests_sha512') A.1.4 Random Number Power-Up Test --------------------------------- The DRNG is tested during power-up this way: 1. Requesting one block of random using the public interface to check general working and the duplicated block detection. 2. 3 know answer tests using pre-defined keys, seed and initial DT values. For each test 3 blocks of 16 bytes are requested and compared to the expected result. The DT value is incremented for each block. A.1.5 Public Key Algorithm Power-Up Tests ----------------------------------------- The public key algorithms are tested during power-up: RSA A pre-defined 1024 bit RSA key is used and these tests are run in turn: 1. Conversion of S-expression to internal format. (`cipher/rsa.c:selftests_rsa') 2. Private key consistency check. (`cipher/rsa.c:selftests_rsa') 3. A pre-defined 20 byte value is signed with PKCS#1 padding for SHA-1. The result is verified using the public key against the original data and against modified data. (`cipher/rsa.c:selftest_sign_1024') 4. A 1000 bit random value is encrypted and checked that it does not match the orginal random value. The encrtypted result is then decrypted and checked that it macthes the original random value. (`cipher/rsa.c:selftest_encr_1024') DSA A pre-defined 1024 bit DSA key is used and these tests are run in turn: 1. Conversion of S-expression to internal format. (`cipher/dsa.c:selftests_dsa') 2. Private key consistency check. (`cipher/dsa.c:selftests_dsa') 3. A pre-defined 20 byte value is signed with PKCS#1 padding for SHA-1. The result is verified using the public key against the original data and against modified data. (`cipher/dsa.c:selftest_sign_1024') A.1.6 Integrity Power-Up Tests ------------------------------ The integrity of the Libgcrypt is tested during power-up but only if checking has been enabled at build time. The check works by computing a HMAC SHA-256 checksum over the file used to load Libgcrypt into memory. That checksum is compared against a checksum stored in a file of the same name but with a single dot as a prefix and a suffix of `.hmac'. A.1.7 Critical Functions Power-Up Tests --------------------------------------- The 3DES weak key detection is tested during power-up by calling the detection function with keys taken from a table listening all weak keys. The table itself is protected using a SHA-1 hash. (`cipher/des.c:selftest') A.2 Conditional Tests ===================== The conditional tests are performed if a certain contidion is met. This may occur at any time; the library does not necessary enter the "Self-Test" state to run these tests but will transit to the "Error" state if a test failed. A.2.1 Key-Pair Generation Tests ------------------------------- After an asymmetric key-pair has been generated, Libgcrypt runs a pair-wise consistency tests on the generated key. On failure the generated key is not used, an error code is returned and, if in FIPS mode, the library is put into the "Error" state. RSA The test uses a random number 64 bits less the size of the modulus as plaintext and runs an encryption and decryption operation in turn. The encrypted value is checked to not match the plaintext and the result of the decryption is checked to match the plaintext. A new random number of the same size is generated, signed and verified to test the correctness of the signing operation. As a second signing test, the signature is modified by incrementing its value and then verified with the expected result that the verification fails. (`cipher/rsa.c:test_keys') DSA The test uses a random number of the size of the Q parameter to create a signature and then checks that the signature verifies. As a second signing test, the data is modified by incrementing its value and then verified against the signature with the expected result that the verification fails. (`cipher/dsa.c:test_keys') A.2.2 Software Load Tests ------------------------- Loading of extra modules into libgcrypt is disabled in FIPS mode and thus no tests are implemented. (`cipher/cipher.c:gcry_cipher_register', `cipher/md.c:gcry_md_register', `cipher/md.c:gcry_pk_register') A.2.3 Manual Key Entry Tests ---------------------------- A manual key entry feature is not implemented in Libgcrypt. A.2.4 Continuous RNG Tests -------------------------- The continuous random number test is only used in FIPS mode. The RNG generates blocks of 128 bit size; the first block generated per context is saved in the context and another block is generated to be returned to the caller. Each block is compared against the saved block and then stored in the context. If a duplicated block is detected an error is signaled and the libray is put into the "Fatal-Error" state. (`random/random-fips.c:x931_aes_driver') A.3 Application Requested Tests =============================== The application may requests tests at any time by means of the `GCRYCTL_SELFTEST' control command. Note that using these tests is not FIPS conform: Although Libgcrypt rejects all application requests for services while running self-tests, it does not ensure that no other operations of Libgcrypt are still being executed. Thus, in FIPS mode an application requesting self-tests needs to power-cycle Libgcrypt instead. When self-tests are requested, Libgcrypt runs all the tests it does during power-up as well as a few extra checks as described below. A.3.1 Symmetric Cipher Algorithm Tests -------------------------------------- The following symmetric encryption algorithm tests are run in addition to the power-up tests: AES-128 A known answer tests with test vectors taken from NIST SP800-38a and using the high level functions is run for block modes CFB and OFB. A.3.2 Hash Algorithm Tests -------------------------- The following hash algorithm tests are run in addition to the power-up tests: SHA-1 SHA-224 SHA-256 1. A known answer test using a 56 byte string is run. 2. A known answer test using a string of one million letters "a" is run. (`cipher/sha1.c:selftests_sha1', `cipher/sha256.c:selftests_sha224', `cipher/sha256.c:selftests_sha256') SHA-384 SHA-512 1. A known answer test using a 112 byte string is run. 2. A known answer test using a string of one million letters "a" is run. (`cipher/sha512.c:selftests_sha384', `cipher/sha512.c:selftests_sha512') A.3.3 MAC Algorithm Tests ------------------------- The following MAC algorithm tests are run in addition to the power-up tests: HMAC SHA-1 1. A known answer test using 9 byte of data and a 20 byte key is run. 2. A known answer test using 9 byte of data and a 100 byte key is run. 3. A known answer test using 9 byte of data and a 49 byte key is run. (`cipher/hmac-tests.c:selftests_sha1') HMAC SHA-224 HMAC SHA-256 HMAC SHA-384 HMAC SHA-512 1. A known answer test using 9 byte of data and a 20 byte key is run. 2. A known answer test using 50 byte of data and a 20 byte key is run. 3. A known answer test using 50 byte of data and a 26 byte key is run. 4. A known answer test using 54 byte of data and a 131 byte key is run. 5. A known answer test using 152 byte of data and a 131 byte key is run. (`cipher/hmac-tests.c:selftests_sha224', `cipher/hmac-tests.c:selftests_sha256', `cipher/hmac-tests.c:selftests_sha384', `cipher/hmac-tests.c:selftests_sha512')  File: gcrypt.info, Node: FIPS Mode, Next: Library Copying, Prev: Self-Tests, Up: Top Appendix B Description of the FIPS Mode *************************************** This appendix gives detailed information pertaining to the FIPS mode. In particular, the changes to the standard mode and the finite state machine are described. The self-tests required in this mode are described in the appendix on self-tests. B.1 Restrictions in FIPS Mode ============================= If Libgcrypt is used in FIPS mode these restrictions are effective: * The cryptographic algorithms are restricted to this list: GCRY_CIPHER_3DES 3 key EDE Triple-DES symmetric encryption. GCRY_CIPHER_AES128 AES 128 bit symmetric encryption. GCRY_CIPHER_AES192 AES 192 bit symmetric encryption. GCRY_CIPHER_AES256 AES 256 bit symmetric encryption. GCRY_MD_SHA1 SHA-1 message digest. GCRY_MD_SHA224 SHA-224 message digest. GCRY_MD_SHA256 SHA-256 message digest. GCRY_MD_SHA384 SHA-384 message digest. GCRY_MD_SHA512 SHA-512 message digest. GCRY_MD_SHA1,GCRY_MD_FLAG_HMAC HMAC using a SHA-1 message digest. GCRY_MD_SHA224,GCRY_MD_FLAG_HMAC HMAC using a SHA-224 message digest. GCRY_MD_SHA256,GCRY_MD_FLAG_HMAC HMAC using a SHA-256 message digest. GCRY_MD_SHA384,GCRY_MD_FLAG_HMAC HMAC using a SHA-384 message digest. GCRY_MD_SHA512,GCRY_MD_FLAG_HMAC HMAC using a SHA-512 message digest. GCRY_PK_RSA RSA encryption and signing. GCRY_PK_DSA DSA signing. Note that the CRC algorithms are not considered cryptographic algorithms and thus are in addition available. * RSA key generation refuses to create a key with a keysize of less than 1024 bits. * DSA key generation refuses to create a key with a keysize other than 1024 bits. * The `transient-key' flag for RSA and DSA key generation is ignored. * Support for the VIA Padlock engine is disabled. * FIPS mode may only be used on systems with a /dev/random device. Switching into FIPS mode on other systems will fail at runtime. * Saving and loading a random seed file is ignored. * An X9.31 style random number generator is used in place of the large-pool-CSPRNG generator. * The command `GCRYCTL_ENABLE_QUICK_RANDOM' is ignored. * The Alternative Public Key Interface (`gcry_ac_xxx') is not supported and all API calls return an error. * Registration of external modules is not supported. * Message digest debugging is disabled. * All debug output related to cryptographic data is suppressed. * On-the-fly self-tests are not performed, instead self-tests are run before entering operational state. * The function `gcry_set_allocation_handler' may not be used. If it is used Libgcrypt disables FIPS mode unless Enforced FIPS mode is enabled, in which case Libgcrypt will enter the error state. * The digest algorithm MD5 may not be used. If it is used Libgcrypt disables FIPS mode unless Enforced FIPS mode is enabled, in which case Libgcrypt will enter the error state. * In Enforced FIPS mode the command `GCRYCTL_DISABLE_SECMEM' is ignored. In standard FIPS mode it disables FIPS mode. * A handler set by `gcry_set_outofcore_handler' is ignored. * A handler set by `gcry_set_fatalerror_handler' is ignored. Note that when we speak about disabling FIPS mode, it merely means that the function `gcry_fips_mode_active' returns false; it does not mean that any non FIPS algorithms are allowed. B.2 FIPS Finite State Machine ============================= The FIPS mode of libgcrypt implements a finite state machine (FSM) using 8 states (*note tbl:fips-states::) and checks at runtime that only valid transitions (*note tbl:fips-state-transitions::) may happen. [image src="fips-fsm.png" alt="FIPS FSM Diagram"] Figure B.1: FIPS mode state diagram States used by the FIPS FSM: Power-Off Libgcrypt is not runtime linked to another application. This usually means that the library is not loaded into main memory. This state is documentation only. Power-On Libgcrypt is loaded into memory and API calls may be made. Compiler introducted constructor functions may be run. Note that Libgcrypt does not implement any arbitrary constructor functions to be called by the operating system Init The Libgcrypt initialization functions are performed and the library has not yet run any self-test. Self-Test Libgcrypt is performing self-tests. Operational Libgcrypt is in the operational state and all interfaces may be used. Error Libgrypt is in the error state. When calling any FIPS relevant interfaces they either return an error (`GPG_ERR_NOT_OPERATIONAL') or put Libgcrypt into the Fatal-Error state and won't return. Fatal-Error Libgcrypt is in a non-recoverable error state and will automatically transit into the Shutdown state. Shutdown Libgcrypt is about to be terminated and removed from the memory. The application may at this point still runing cleanup handlers. Table B.1: FIPS mode states The valid state transitions (*note Figure B.1: fig:fips-fsm.) are: `1' Power-Off to Power-On is implicitly done by the OS loading Libgcrypt as a shared library and having it linked to an application. `2' Power-On to Init is triggered by the application calling the Libgcrypt intialization function `gcry_check_version'. `3' Init to Self-Test is either triggred by a dedicated API call or implicit by invoking a libgrypt service conrolled by the FSM. `4' Self-Test to Operational is triggered after all self-tests passed successfully. `5' Operational to Shutdown is an artifical state without any direct action in Libgcrypt. When reaching the Shutdown state the library is deinitialized and can't return to any other state again. `6' Shutdown to Power-off is the process of removing Libgcrypt from the computer's memory. For obvious reasons the Power-Off state can't be represented within Libgcrypt and thus this transition is for documentation only. `7' Operational to Error is triggered if Libgcrypt detected an application error which can't be returned to the caller but still allows Libgcrypt to properly run. In the Error state all FIPS relevant interfaces return an error code. `8' Error to Shutdown is similar to the Operational to Shutdown transition (5). `9' Error to Fatal-Error is triggred if Libgrypt detects an fatal error while already being in Error state. `10' Fatal-Error to Shutdown is automatically entered by Libgcrypt after having reported the error. `11' Power-On to Shutdown is an artifical state to document that Libgcrypt has not ye been initializaed but the process is about to terminate. `12' Power-On to Fatal-Error will be triggerd if certain Libgcrypt functions are used without having reached the Init state. `13' Self-Test to Fatal-Error is triggred by severe errors in Libgcrypt while running self-tests. `14' Self-Test to Error is triggred by a failed self-test. `15' Operational to Fatal-Error is triggered if Libcrypt encountered a non-recoverable error. `16' Operational to Self-Test is triggred if the application requested to run the self-tests again. `17' Error to Self-Test is triggered if the application has requested to run self-tests to get to get back into operational state after an error. `18' Init to Error is triggered by errors in the initialization code. `19' Init to Fatal-Error is triggered by non-recoverable errors in the initialization code. `20' Error to Error is triggered by errors while already in the Error state. Table B.2: FIPS mode state transitions B.3 FIPS Miscellaneous Information ================================== Libgcrypt does not do any key management on itself; the application needs to care about it. Keys which are passed to Libgcrypt should be allocated in secure memory as available with the functions `gcry_malloc_secure' and `gcry_calloc_secure'. By calling `gcry_free' on this memory, the memory and thus the keys are overwritten with zero bytes before releasing the memory. For use with the random number generator, Libgcrypt generates 3 internal keys which are stored in the encryption contexts used by the RNG. These keys are stored in secure memory for the lifetime of the process. Application are required to use `GCRYCTL_TERM_SECMEM' before process termination. This will zero out the entire secure memory and thus also the encryption contexts with these keys.  File: gcrypt.info, Node: Library Copying, Next: Copying, Prev: FIPS Mode, Up: Top GNU Lesser General Public License ********************************* Version 2.1, February 1999 Copyright (C) 1991, 1999 Free Software Foundation, Inc. 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA Everyone is permitted to copy and distribute verbatim copies of this license document, but changing it is not allowed. [This is the first released version of the Lesser GPL. It also counts as the successor of the GNU Library Public License, version 2, hence the version number 2.1.] Preamble ======== The licenses for most software are designed to take away your freedom to share and change it. By contrast, the GNU General Public Licenses are intended to guarantee your freedom to share and change free software--to make sure the software is free for all its users. This license, the Lesser General Public License, applies to some specially designated software--typically libraries--of the Free Software Foundation and other authors who decide to use it. You can use it too, but we suggest you first think carefully about whether this license or the ordinary General Public License is the better strategy to use in any particular case, based on the explanations below. When we speak of free software, we are referring to freedom of use, not price. Our General Public Licenses are designed to make sure that you have the freedom to distribute copies of free software (and charge for this service if you wish); that you receive source code or can get it if you want it; that you can change the software and use pieces of it in new free programs; and that you are informed that you can do these things. To protect your rights, we need to make restrictions that forbid distributors to deny you these rights or to ask you to surrender these rights. These restrictions translate to certain responsibilities for you if you distribute copies of the library or if you modify it. For example, if you distribute copies of the library, whether gratis or for a fee, you must give the recipients all the rights that we gave you. You must make sure that they, too, receive or can get the source code. If you link other code with the library, you must provide complete object files to the recipients, so that they can relink them with the library after making changes to the library and recompiling it. And you must show them these terms so they know their rights. We protect your rights with a two-step method: (1) we copyright the library, and (2) we offer you this license, which gives you legal permission to copy, distribute and/or modify the library. To protect each distributor, we want to make it very clear that there is no warranty for the free library. Also, if the library is modified by someone else and passed on, the recipients should know that what they have is not the original version, so that the original author's reputation will not be affected by problems that might be introduced by others. Finally, software patents pose a constant threat to the existence of any free program. We wish to make sure that a company cannot effectively restrict the users of a free program by obtaining a restrictive license from a patent holder. Therefore, we insist that any patent license obtained for a version of the library must be consistent with the full freedom of use specified in this license. Most GNU software, including some libraries, is covered by the ordinary GNU General Public License. This license, the GNU Lesser General Public License, applies to certain designated libraries, and is quite different from the ordinary General Public License. We use this license for certain libraries in order to permit linking those libraries into non-free programs. When a program is linked with a library, whether statically or using a shared library, the combination of the two is legally speaking a combined work, a derivative of the original library. The ordinary General Public License therefore permits such linking only if the entire combination fits its criteria of freedom. The Lesser General Public License permits more lax criteria for linking other code with the library. We call this license the "Lesser" General Public License because it does _Less_ to protect the user's freedom than the ordinary General Public License. It also provides other free software developers Less of an advantage over competing non-free programs. These disadvantages are the reason we use the ordinary General Public License for many libraries. However, the Lesser license provides advantages in certain special circumstances. For example, on rare occasions, there may be a special need to encourage the widest possible use of a certain library, so that it becomes a de-facto standard. To achieve this, non-free programs must be allowed to use the library. A more frequent case is that a free library does the same job as widely used non-free libraries. In this case, there is little to gain by limiting the free library to free software only, so we use the Lesser General Public License. In other cases, permission to use a particular library in non-free programs enables a greater number of people to use a large body of free software. For example, permission to use the GNU C Library in non-free programs enables many more people to use the whole GNU operating system, as well as its variant, the GNU/Linux operating system. Although the Lesser General Public License is Less protective of the users' freedom, it does ensure that the user of a program that is linked with the Library has the freedom and the wherewithal to run that program using a modified version of the Library. The precise terms and conditions for copying, distribution and modification follow. Pay close attention to the difference between a "work based on the library" and a "work that uses the library". The former contains code derived from the library, whereas the latter must be combined with the library in order to run. GNU LESSER GENERAL PUBLIC LICENSE TERMS AND CONDITIONS FOR COPYING, DISTRIBUTION AND MODIFICATION 0. This License Agreement applies to any software library or other program which contains a notice placed by the copyright holder or other authorized party saying it may be distributed under the terms of this Lesser General Public License (also called "this License"). Each licensee is addressed as "you". A "library" means a collection of software functions and/or data prepared so as to be conveniently linked with application programs (which use some of those functions and data) to form executables. The "Library", below, refers to any such software library or work which has been distributed under these terms. A "work based on the Library" means either the Library or any derivative work under copyright law: that is to say, a work containing the Library or a portion of it, either verbatim or with modifications and/or translated straightforwardly into another language. (Hereinafter, translation is included without limitation in the term "modification".) "Source code" for a work means the preferred form of the work for making modifications to it. For a library, complete source code means all the source code for all modules it contains, plus any associated interface definition files, plus the scripts used to control compilation and installation of the library. Activities other than copying, distribution and modification are not covered by this License; they are outside its scope. The act of running a program using the Library is not restricted, and output from such a program is covered only if its contents constitute a work based on the Library (independent of the use of the Library in a tool for writing it). Whether that is true depends on what the Library does and what the program that uses the Library does. 1. You may copy and distribute verbatim copies of the Library's complete source code as you receive it, in any medium, provided that you conspicuously and appropriately publish on each copy an appropriate copyright notice and disclaimer of warranty; keep intact all the notices that refer to this License and to the absence of any warranty; and distribute a copy of this License along with the Library. You may charge a fee for the physical act of transferring a copy, and you may at your option offer warranty protection in exchange for a fee. 2. You may modify your copy or copies of the Library or any portion of it, thus forming a work based on the Library, and copy and distribute such modifications or work under the terms of Section 1 above, provided that you also meet all of these conditions: a. The modified work must itself be a software library. b. You must cause the files modified to carry prominent notices stating that you changed the files and the date of any change. c. You must cause the whole of the work to be licensed at no charge to all third parties under the terms of this License. d. If a facility in the modified Library refers to a function or a table of data to be supplied by an application program that uses the facility, other than as an argument passed when the facility is invoked, then you must make a good faith effort to ensure that, in the event an application does not supply such function or table, the facility still operates, and performs whatever part of its purpose remains meaningful. (For example, a function in a library to compute square roots has a purpose that is entirely well-defined independent of the application. Therefore, Subsection 2d requires that any application-supplied function or table used by this function must be optional: if the application does not supply it, the square root function must still compute square roots.) These requirements apply to the modified work as a whole. If identifiable sections of that work are not derived from the Library, and can be reasonably considered independent and separate works in themselves, then this License, and its terms, do not apply to those sections when you distribute them as separate works. But when you distribute the same sections as part of a whole which is a work based on the Library, the distribution of the whole must be on the terms of this License, whose permissions for other licensees extend to the entire whole, and thus to each and every part regardless of who wrote it. Thus, it is not the intent of this section to claim rights or contest your rights to work written entirely by you; rather, the intent is to exercise the right to control the distribution of derivative or collective works based on the Library. In addition, mere aggregation of another work not based on the Library with the Library (or with a work based on the Library) on a volume of a storage or distribution medium does not bring the other work under the scope of this License. 3. You may opt to apply the terms of the ordinary GNU General Public License instead of this License to a given copy of the Library. To do this, you must alter all the notices that refer to this License, so that they refer to the ordinary GNU General Public License, version 2, instead of to this License. (If a newer version than version 2 of the ordinary GNU General Public License has appeared, then you can specify that version instead if you wish.) Do not make any other change in these notices. Once this change is made in a given copy, it is irreversible for that copy, so the ordinary GNU General Public License applies to all subsequent copies and derivative works made from that copy. This option is useful when you wish to copy part of the code of the Library into a program that is not a library. 4. You may copy and distribute the Library (or a portion or derivative of it, under Section 2) in object code or executable form under the terms of Sections 1 and 2 above provided that you accompany it with the complete corresponding machine-readable source code, which must be distributed under the terms of Sections 1 and 2 above on a medium customarily used for software interchange. If distribution of object code is made by offering access to copy from a designated place, then offering equivalent access to copy the source code from the same place satisfies the requirement to distribute the source code, even though third parties are not compelled to copy the source along with the object code. 5. A program that contains no derivative of any portion of the Library, but is designed to work with the Library by being compiled or linked with it, is called a "work that uses the Library". Such a work, in isolation, is not a derivative work of the Library, and therefore falls outside the scope of this License. However, linking a "work that uses the Library" with the Library creates an executable that is a derivative of the Library (because it contains portions of the Library), rather than a "work that uses the library". The executable is therefore covered by this License. Section 6 states terms for distribution of such executables. When a "work that uses the Library" uses material from a header file that is part of the Library, the object code for the work may be a derivative work of the Library even though the source code is not. Whether this is true is especially significant if the work can be linked without the Library, or if the work is itself a library. The threshold for this to be true is not precisely defined by law. If such an object file uses only numerical parameters, data structure layouts and accessors, and small macros and small inline functions (ten lines or less in length), then the use of the object file is unrestricted, regardless of whether it is legally a derivative work. (Executables containing this object code plus portions of the Library will still fall under Section 6.) Otherwise, if the work is a derivative of the Library, you may distribute the object code for the work under the terms of Section 6. Any executables containing that work also fall under Section 6, whether or not they are linked directly with the Library itself. 6. As an exception to the Sections above, you may also combine or link a "work that uses the Library" with the Library to produce a work containing portions of the Library, and distribute that work under terms of your choice, provided that the terms permit modification of the work for the customer's own use and reverse engineering for debugging such modifications. You must give prominent notice with each copy of the work that the Library is used in it and that the Library and its use are covered by this License. You must supply a copy of this License. If the work during execution displays copyright notices, you must include the copyright notice for the Library among them, as well as a reference directing the user to the copy of this License. Also, you must do one of these things: a. Accompany the work with the complete corresponding machine-readable source code for the Library including whatever changes were used in the work (which must be distributed under Sections 1 and 2 above); and, if the work is an executable linked with the Library, with the complete machine-readable "work that uses the Library", as object code and/or source code, so that the user can modify the Library and then relink to produce a modified executable containing the modified Library. (It is understood that the user who changes the contents of definitions files in the Library will not necessarily be able to recompile the application to use the modified definitions.) b. Use a suitable shared library mechanism for linking with the Library. A suitable mechanism is one that (1) uses at run time a copy of the library already present on the user's computer system, rather than copying library functions into the executable, and (2) will operate properly with a modified version of the library, if the user installs one, as long as the modified version is interface-compatible with the version that the work was made with. c. Accompany the work with a written offer, valid for at least three years, to give the same user the materials specified in Subsection 6a, above, for a charge no more than the cost of performing this distribution. d. If distribution of the work is made by offering access to copy from a designated place, offer equivalent access to copy the above specified materials from the same place. e. Verify that the user has already received a copy of these materials or that you have already sent this user a copy. For an executable, the required form of the "work that uses the Library" must include any data and utility programs needed for reproducing the executable from it. However, as a special exception, the materials to be distributed need not include anything that is normally distributed (in either source or binary form) with the major components (compiler, kernel, and so on) of the operating system on which the executable runs, unless that component itself accompanies the executable. It may happen that this requirement contradicts the license restrictions of other proprietary libraries that do not normally accompany the operating system. Such a contradiction means you cannot use both them and the Library together in an executable that you distribute. 7. You may place library facilities that are a work based on the Library side-by-side in a single library together with other library facilities not covered by this License, and distribute such a combined library, provided that the separate distribution of the work based on the Library and of the other library facilities is otherwise permitted, and provided that you do these two things: a. Accompany the combined library with a copy of the same work based on the Library, uncombined with any other library facilities. This must be distributed under the terms of the Sections above. b. Give prominent notice with the combined library of the fact that part of it is a work based on the Library, and explaining where to find the accompanying uncombined form of the same work. 8. You may not copy, modify, sublicense, link with, or distribute the Library except as expressly provided under this License. Any attempt otherwise to copy, modify, sublicense, link with, or distribute the Library is void, and will automatically terminate your rights under this License. However, parties who have received copies, or rights, from you under this License will not have their licenses terminated so long as such parties remain in full compliance. 9. You are not required to accept this License, since you have not signed it. However, nothing else grants you permission to modify or distribute the Library or its derivative works. These actions are prohibited by law if you do not accept this License. Therefore, by modifying or distributing the Library (or any work based on the Library), you indicate your acceptance of this License to do so, and all its terms and conditions for copying, distributing or modifying the Library or works based on it. 10. Each time you redistribute the Library (or any work based on the Library), the recipient automatically receives a license from the original licensor to copy, distribute, link with or modify the Library subject to these terms and conditions. You may not impose any further restrictions on the recipients' exercise of the rights granted herein. You are not responsible for enforcing compliance by third parties with this License. 11. If, as a consequence of a court judgment or allegation of patent infringement or for any other reason (not limited to patent issues), conditions are imposed on you (whether by court order, agreement or otherwise) that contradict the conditions of this License, they do not excuse you from the conditions of this License. If you cannot distribute so as to satisfy simultaneously your obligations under this License and any other pertinent obligations, then as a consequence you may not distribute the Library at all. For example, if a patent license would not permit royalty-free redistribution of the Library by all those who receive copies directly or indirectly through you, then the only way you could satisfy both it and this License would be to refrain entirely from distribution of the Library. If any portion of this section is held invalid or unenforceable under any particular circumstance, the balance of the section is intended to apply, and the section as a whole is intended to apply in other circumstances. It is not the purpose of this section to induce you to infringe any patents or other property right claims or to contest validity of any such claims; this section has the sole purpose of protecting the integrity of the free software distribution system which is implemented by public license practices. Many people have made generous contributions to the wide range of software distributed through that system in reliance on consistent application of that system; it is up to the author/donor to decide if he or she is willing to distribute software through any other system and a licensee cannot impose that choice. This section is intended to make thoroughly clear what is believed to be a consequence of the rest of this License. 12. If the distribution and/or use of the Library is restricted in certain countries either by patents or by copyrighted interfaces, the original copyright holder who places the Library under this License may add an explicit geographical distribution limitation excluding those countries, so that distribution is permitted only in or among countries not thus excluded. In such case, this License incorporates the limitation as if written in the body of this License. 13. The Free Software Foundation may publish revised and/or new versions of the Lesser General Public License from time to time. Such new versions will be similar in spirit to the present version, but may differ in detail to address new problems or concerns. Each version is given a distinguishing version number. If the Library specifies a version number of this License which applies to it and "any later version", you have the option of following the terms and conditions either of that version or of any later version published by the Free Software Foundation. If the Library does not specify a license version number, you may choose any version ever published by the Free Software Foundation. 14. If you wish to incorporate parts of the Library into other free programs whose distribution conditions are incompatible with these, write to the author to ask for permission. For software which is copyrighted by the Free Software Foundation, write to the Free Software Foundation; we sometimes make exceptions for this. Our decision will be guided by the two goals of preserving the free status of all derivatives of our free software and of promoting the sharing and reuse of software generally. NO WARRANTY 15. BECAUSE THE LIBRARY IS LICENSED FREE OF CHARGE, THERE IS NO WARRANTY FOR THE LIBRARY, TO THE EXTENT PERMITTED BY APPLICABLE LAW. EXCEPT WHEN OTHERWISE STATED IN WRITING THE COPYRIGHT HOLDERS AND/OR OTHER PARTIES PROVIDE THE LIBRARY "AS IS" WITHOUT WARRANTY OF ANY KIND, EITHER EXPRESSED OR IMPLIED, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. THE ENTIRE RISK AS TO THE QUALITY AND PERFORMANCE OF THE LIBRARY IS WITH YOU. SHOULD THE LIBRARY PROVE DEFECTIVE, YOU ASSUME THE COST OF ALL NECESSARY SERVICING, REPAIR OR CORRECTION. 16. IN NO EVENT UNLESS REQUIRED BY APPLICABLE LAW OR AGREED TO IN WRITING WILL ANY COPYRIGHT HOLDER, OR ANY OTHER PARTY WHO MAY MODIFY AND/OR REDISTRIBUTE THE LIBRARY AS PERMITTED ABOVE, BE LIABLE TO YOU FOR DAMAGES, INCLUDING ANY GENERAL, SPECIAL, INCIDENTAL OR CONSEQUENTIAL DAMAGES ARISING OUT OF THE USE OR INABILITY TO USE THE LIBRARY (INCLUDING BUT NOT LIMITED TO LOSS OF DATA OR DATA BEING RENDERED INACCURATE OR LOSSES SUSTAINED BY YOU OR THIRD PARTIES OR A FAILURE OF THE LIBRARY TO OPERATE WITH ANY OTHER SOFTWARE), EVEN IF SUCH HOLDER OR OTHER PARTY HAS BEEN ADVISED OF THE POSSIBILITY OF SUCH DAMAGES. END OF TERMS AND CONDITIONS How to Apply These Terms to Your New Libraries ============================================== If you develop a new library, and you want it to be of the greatest possible use to the public, we recommend making it free software that everyone can redistribute and change. You can do so by permitting redistribution under these terms (or, alternatively, under the terms of the ordinary General Public License). To apply these terms, attach the following notices to the library. It is safest to attach them to the start of each source file to most effectively convey the exclusion of warranty; and each file should have at least the "copyright" line and a pointer to where the full notice is found. ONE LINE TO GIVE THE LIBRARY'S NAME AND AN IDEA OF WHAT IT DOES. Copyright (C) YEAR NAME OF AUTHOR This library is free software; you can redistribute it and/or modify it under the terms of the GNU Lesser General Public License as published by the Free Software Foundation; either version 2.1 of the License, or (at your option) any later version. This library is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Lesser General Public License for more details. You should have received a copy of the GNU Lesser General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307, USA. Also add information on how to contact you by electronic and paper mail. You should also get your employer (if you work as a programmer) or your school, if any, to sign a "copyright disclaimer" for the library, if necessary. Here is a sample; alter the names: Yoyodyne, Inc., hereby disclaims all copyright interest in the library `Frob' (a library for tweaking knobs) written by James Random Hacker. SIGNATURE OF TY COON, 1 April 1990 Ty Coon, President of Vice That's all there is to it!  File: gcrypt.info, Node: Copying, Next: Figures and Tables, Prev: Library Copying, Up: Top GNU General Public License ************************** Version 2, June 1991 Copyright (C) 1989, 1991 Free Software Foundation, Inc. 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA Everyone is permitted to copy and distribute verbatim copies of this license document, but changing it is not allowed. Preamble ======== The licenses for most software are designed to take away your freedom to share and change it. By contrast, the GNU General Public License is intended to guarantee your freedom to share and change free software--to make sure the software is free for all its users. This General Public License applies to most of the Free Software Foundation's software and to any other program whose authors commit to using it. (Some other Free Software Foundation software is covered by the GNU Library General Public License instead.) You can apply it to your programs, too. When we speak of free software, we are referring to freedom, not price. Our General Public Licenses are designed to make sure that you have the freedom to distribute copies of free software (and charge for this service if you wish), that you receive source code or can get it if you want it, that you can change the software or use pieces of it in new free programs; and that you know you can do these things. To protect your rights, we need to make restrictions that forbid anyone to deny you these rights or to ask you to surrender the rights. These restrictions translate to certain responsibilities for you if you distribute copies of the software, or if you modify it. For example, if you distribute copies of such a program, whether gratis or for a fee, you must give the recipients all the rights that you have. You must make sure that they, too, receive or can get the source code. And you must show them these terms so they know their rights. We protect your rights with two steps: (1) copyright the software, and (2) offer you this license which gives you legal permission to copy, distribute and/or modify the software. Also, for each author's protection and ours, we want to make certain that everyone understands that there is no warranty for this free software. If the software is modified by someone else and passed on, we want its recipients to know that what they have is not the original, so that any problems introduced by others will not reflect on the original authors' reputations. Finally, any free program is threatened constantly by software patents. We wish to avoid the danger that redistributors of a free program will individually obtain patent licenses, in effect making the program proprietary. To prevent this, we have made it clear that any patent must be licensed for everyone's free use or not licensed at all. The precise terms and conditions for copying, distribution and modification follow. TERMS AND CONDITIONS FOR COPYING, DISTRIBUTION AND MODIFICATION 1. This License applies to any program or other work which contains a notice placed by the copyright holder saying it may be distributed under the terms of this General Public License. The "Program", below, refers to any such program or work, and a "work based on the Program" means either the Program or any derivative work under copyright law: that is to say, a work containing the Program or a portion of it, either verbatim or with modifications and/or translated into another language. (Hereinafter, translation is included without limitation in the term "modification".) Each licensee is addressed as "you". Activities other than copying, distribution and modification are not covered by this License; they are outside its scope. The act of running the Program is not restricted, and the output from the Program is covered only if its contents constitute a work based on the Program (independent of having been made by running the Program). Whether that is true depends on what the Program does. 2. You may copy and distribute verbatim copies of the Program's source code as you receive it, in any medium, provided that you conspicuously and appropriately publish on each copy an appropriate copyright notice and disclaimer of warranty; keep intact all the notices that refer to this License and to the absence of any warranty; and give any other recipients of the Program a copy of this License along with the Program. You may charge a fee for the physical act of transferring a copy, and you may at your option offer warranty protection in exchange for a fee. 3. You may modify your copy or copies of the Program or any portion of it, thus forming a work based on the Program, and copy and distribute such modifications or work under the terms of Section 1 above, provided that you also meet all of these conditions: a. You must cause the modified files to carry prominent notices stating that you changed the files and the date of any change. b. You must cause any work that you distribute or publish, that in whole or in part contains or is derived from the Program or any part thereof, to be licensed as a whole at no charge to all third parties under the terms of this License. c. If the modified program normally reads commands interactively when run, you must cause it, when started running for such interactive use in the most ordinary way, to print or display an announcement including an appropriate copyright notice and a notice that there is no warranty (or else, saying that you provide a warranty) and that users may redistribute the program under these conditions, and telling the user how to view a copy of this License. (Exception: if the Program itself is interactive but does not normally print such an announcement, your work based on the Program is not required to print an announcement.) These requirements apply to the modified work as a whole. If identifiable sections of that work are not derived from the Program, and can be reasonably considered independent and separate works in themselves, then this License, and its terms, do not apply to those sections when you distribute them as separate works. But when you distribute the same sections as part of a whole which is a work based on the Program, the distribution of the whole must be on the terms of this License, whose permissions for other licensees extend to the entire whole, and thus to each and every part regardless of who wrote it. Thus, it is not the intent of this section to claim rights or contest your rights to work written entirely by you; rather, the intent is to exercise the right to control the distribution of derivative or collective works based on the Program. In addition, mere aggregation of another work not based on the Program with the Program (or with a work based on the Program) on a volume of a storage or distribution medium does not bring the other work under the scope of this License. 4. You may copy and distribute the Program (or a work based on it, under Section 2) in object code or executable form under the terms of Sections 1 and 2 above provided that you also do one of the following: a. Accompany it with the complete corresponding machine-readable source code, which must be distributed under the terms of Sections 1 and 2 above on a medium customarily used for software interchange; or, b. Accompany it with a written offer, valid for at least three years, to give any third party, for a charge no more than your cost of physically performing source distribution, a complete machine-readable copy of the corresponding source code, to be distributed under the terms of Sections 1 and 2 above on a medium customarily used for software interchange; or, c. Accompany it with the information you received as to the offer to distribute corresponding source code. (This alternative is allowed only for noncommercial distribution and only if you received the program in object code or executable form with such an offer, in accord with Subsection b above.) The source code for a work means the preferred form of the work for making modifications to it. For an executable work, complete source code means all the source code for all modules it contains, plus any associated interface definition files, plus the scripts used to control compilation and installation of the executable. However, as a special exception, the source code distributed need not include anything that is normally distributed (in either source or binary form) with the major components (compiler, kernel, and so on) of the operating system on which the executable runs, unless that component itself accompanies the executable. If distribution of executable or object code is made by offering access to copy from a designated place, then offering equivalent access to copy the source code from the same place counts as distribution of the source code, even though third parties are not compelled to copy the source along with the object code. 5. You may not copy, modify, sublicense, or distribute the Program except as expressly provided under this License. Any attempt otherwise to copy, modify, sublicense or distribute the Program is void, and will automatically terminate your rights under this License. However, parties who have received copies, or rights, from you under this License will not have their licenses terminated so long as such parties remain in full compliance. 6. You are not required to accept this License, since you have not signed it. However, nothing else grants you permission to modify or distribute the Program or its derivative works. These actions are prohibited by law if you do not accept this License. Therefore, by modifying or distributing the Program (or any work based on the Program), you indicate your acceptance of this License to do so, and all its terms and conditions for copying, distributing or modifying the Program or works based on it. 7. Each time you redistribute the Program (or any work based on the Program), the recipient automatically receives a license from the original licensor to copy, distribute or modify the Program subject to these terms and conditions. You may not impose any further restrictions on the recipients' exercise of the rights granted herein. You are not responsible for enforcing compliance by third parties to this License. 8. If, as a consequence of a court judgment or allegation of patent infringement or for any other reason (not limited to patent issues), conditions are imposed on you (whether by court order, agreement or otherwise) that contradict the conditions of this License, they do not excuse you from the conditions of this License. If you cannot distribute so as to satisfy simultaneously your obligations under this License and any other pertinent obligations, then as a consequence you may not distribute the Program at all. For example, if a patent license would not permit royalty-free redistribution of the Program by all those who receive copies directly or indirectly through you, then the only way you could satisfy both it and this License would be to refrain entirely from distribution of the Program. If any portion of this section is held invalid or unenforceable under any particular circumstance, the balance of the section is intended to apply and the section as a whole is intended to apply in other circumstances. It is not the purpose of this section to induce you to infringe any patents or other property right claims or to contest validity of any such claims; this section has the sole purpose of protecting the integrity of the free software distribution system, which is implemented by public license practices. Many people have made generous contributions to the wide range of software distributed through that system in reliance on consistent application of that system; it is up to the author/donor to decide if he or she is willing to distribute software through any other system and a licensee cannot impose that choice. This section is intended to make thoroughly clear what is believed to be a consequence of the rest of this License. 9. If the distribution and/or use of the Program is restricted in certain countries either by patents or by copyrighted interfaces, the original copyright holder who places the Program under this License may add an explicit geographical distribution limitation excluding those countries, so that distribution is permitted only in or among countries not thus excluded. In such case, this License incorporates the limitation as if written in the body of this License. 10. The Free Software Foundation may publish revised and/or new versions of the General Public License from time to time. Such new versions will be similar in spirit to the present version, but may differ in detail to address new problems or concerns. Each version is given a distinguishing version number. If the Program specifies a version number of this License which applies to it and "any later version", you have the option of following the terms and conditions either of that version or of any later version published by the Free Software Foundation. If the Program does not specify a version number of this License, you may choose any version ever published by the Free Software Foundation. 11. If you wish to incorporate parts of the Program into other free programs whose distribution conditions are different, write to the author to ask for permission. For software which is copyrighted by the Free Software Foundation, write to the Free Software Foundation; we sometimes make exceptions for this. Our decision will be guided by the two goals of preserving the free status of all derivatives of our free software and of promoting the sharing and reuse of software generally. NO WARRANTY 12. BECAUSE THE PROGRAM IS LICENSED FREE OF CHARGE, THERE IS NO WARRANTY FOR THE PROGRAM, TO THE EXTENT PERMITTED BY APPLICABLE LAW. EXCEPT WHEN OTHERWISE STATED IN WRITING THE COPYRIGHT HOLDERS AND/OR OTHER PARTIES PROVIDE THE PROGRAM "AS IS" WITHOUT WARRANTY OF ANY KIND, EITHER EXPRESSED OR IMPLIED, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. THE ENTIRE RISK AS TO THE QUALITY AND PERFORMANCE OF THE PROGRAM IS WITH YOU. SHOULD THE PROGRAM PROVE DEFECTIVE, YOU ASSUME THE COST OF ALL NECESSARY SERVICING, REPAIR OR CORRECTION. 13. IN NO EVENT UNLESS REQUIRED BY APPLICABLE LAW OR AGREED TO IN WRITING WILL ANY COPYRIGHT HOLDER, OR ANY OTHER PARTY WHO MAY MODIFY AND/OR REDISTRIBUTE THE PROGRAM AS PERMITTED ABOVE, BE LIABLE TO YOU FOR DAMAGES, INCLUDING ANY GENERAL, SPECIAL, INCIDENTAL OR CONSEQUENTIAL DAMAGES ARISING OUT OF THE USE OR INABILITY TO USE THE PROGRAM (INCLUDING BUT NOT LIMITED TO LOSS OF DATA OR DATA BEING RENDERED INACCURATE OR LOSSES SUSTAINED BY YOU OR THIRD PARTIES OR A FAILURE OF THE PROGRAM TO OPERATE WITH ANY OTHER PROGRAMS), EVEN IF SUCH HOLDER OR OTHER PARTY HAS BEEN ADVISED OF THE POSSIBILITY OF SUCH DAMAGES. END OF TERMS AND CONDITIONS How to Apply These Terms to Your New Programs ============================================= If you develop a new program, and you want it to be of the greatest possible use to the public, the best way to achieve this is to make it free software which everyone can redistribute and change under these terms. To do so, attach the following notices to the program. It is safest to attach them to the start of each source file to most effectively convey the exclusion of warranty; and each file should have at least the "copyright" line and a pointer to where the full notice is found. ONE LINE TO GIVE THE PROGRAM'S NAME AND AN IDEA OF WHAT IT DOES. Copyright (C) 19YY NAME OF AUTHOR This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307, USA. Also add information on how to contact you by electronic and paper mail. If the program is interactive, make it output a short notice like this when it starts in an interactive mode: Gnomovision version 69, Copyright (C) 19YY NAME OF AUTHOR Gnomovision comes with ABSOLUTELY NO WARRANTY; for details type `show w'. This is free software, and you are welcome to redistribute it under certain conditions; type `show c' for details. The hypothetical commands `show w' and `show c' should show the appropriate parts of the General Public License. Of course, the commands you use may be called something other than `show w' and `show c'; they could even be mouse-clicks or menu items--whatever suits your program. You should also get your employer (if you work as a programmer) or your school, if any, to sign a "copyright disclaimer" for the program, if necessary. Here is a sample; alter the names: Yoyodyne, Inc., hereby disclaims all copyright interest in the program `Gnomovision' (which makes passes at compilers) written by James Hacker. SIGNATURE OF TY COON, 1 April 1989 Ty Coon, President of Vice This General Public License does not permit incorporating your program into proprietary programs. If your program is a subroutine library, you may consider it more useful to permit linking proprietary applications with the library. If this is what you want to do, use the GNU Library General Public License instead of this License.  File: gcrypt.info, Node: Figures and Tables, Next: Concept Index, Prev: Copying, Up: Top List of Figures and Tables ************************** * Menu: * Figure 13.1: Libgcrypt subsystems: fig:subsystems. * Figure B.1: FIPS mode state ...: fig:fips-fsm. * Menu: * Table B.1: FIPS mode states: tbl:fips-states. * Table B.2: FIPS mode state ...: tbl:fips-state-transitions.  File: gcrypt.info, Node: Concept Index, Next: Function and Data Index, Prev: Figures and Tables, Up: Top Concept Index ************* [index] * Menu: * 3DES: Available ciphers. (line 16) * Advanced Encryption Standard: Available ciphers. (line 37) * AES: Available ciphers. (line 37) * Arcfour: Available ciphers. (line 54) * Blowfish: Available ciphers. (line 24) * Camellia: Available ciphers. (line 81) * CAST5: Available ciphers. (line 21) * CBC, Cipher Block Chaining mode: Available cipher modes. (line 20) * CBC-MAC: Working with cipher handles. (line 52) * CFB, Cipher Feedback mode: Available cipher modes. (line 16) * cipher text stealing: Working with cipher handles. (line 45) * CRC32: Available hash algorithms. (line 6) * CTR, Counter mode: Available cipher modes. (line 29) * DES: Available ciphers. (line 59) * DES-EDE: Available ciphers. (line 16) * Digital Encryption Standard: Available ciphers. (line 16) * ECB, Electronic Codebook mode: Available cipher modes. (line 13) * Enforced FIPS mode: Enabling FIPS mode. (line 30) * error codes: Error Values. (line 6) * error codes, list of <1>: Error Codes. (line 6) * error codes, list of: Error Sources. (line 6) * error codes, printing of: Error Strings. (line 6) * error sources: Error Values. (line 6) * error sources, printing of: Error Strings. (line 6) * error strings: Error Strings. (line 6) * error values: Error Values. (line 6) * error values, printing of: Error Strings. (line 6) * FIPS 140: Enabling FIPS mode. (line 6) * FIPS 186 <1>: Public-Key Subsystem Architecture. (line 63) * FIPS 186: General public-key related Functions. (line 256) * FIPS mode: Enabling FIPS mode. (line 6) * GPL, GNU General Public License: Copying. (line 6) * HAVAL: Available hash algorithms. (line 6) * HMAC: Working with hash algorithms. (line 27) * IDEA: Available ciphers. (line 11) * LGPL, GNU Lesser General Public License: Library Copying. (line 6) * MD2, MD4, MD5: Available hash algorithms. (line 6) * OFB, Output Feedback mode: Available cipher modes. (line 26) * RC2: Available ciphers. (line 71) * RC4: Available ciphers. (line 54) * rfc-2268: Available ciphers. (line 71) * Rijndael: Available ciphers. (line 37) * RIPE-MD-160: Available hash algorithms. (line 6) * Seed (cipher): Available ciphers. (line 76) * Serpent: Available ciphers. (line 67) * SHA-1: Available hash algorithms. (line 6) * SHA-224, SHA-256, SHA-384, SHA-512: Available hash algorithms. (line 6) * sync mode (OpenPGP): Working with cipher handles. (line 40) * TIGER: Available hash algorithms. (line 6) * Triple-DES: Available ciphers. (line 16) * Twofish: Available ciphers. (line 48) * Whirlpool: Available hash algorithms. (line 6) * X9.31 <1>: Public-Key Subsystem Architecture. (line 63) * X9.31: General public-key related Functions. (line 249)  File: gcrypt.info, Node: Function and Data Index, Prev: Concept Index, Up: Top Function and Data Index *********************** [index] * Menu: * AM_PATH_LIBGCRYPT: Building sources using Automake. (line 13) * gcry_ac_close: Working with handles. (line 21) * gcry_ac_data_clear: Working with sets of data. (line 75) * gcry_ac_data_copy: Working with sets of data. (line 53) * gcry_ac_data_decode: Using cryptographic functions. (line 100) * gcry_ac_data_decrypt: Using cryptographic functions. (line 40) * gcry_ac_data_decrypt_scheme: Using cryptographic functions. (line 137) * gcry_ac_data_destroy: Working with sets of data. (line 41) * gcry_ac_data_encode: Using cryptographic functions. (line 93) * gcry_ac_data_encrypt: Using cryptographic functions. (line 33) * gcry_ac_data_encrypt_scheme: Using cryptographic functions. (line 127) * gcry_ac_data_from_sexp: Working with sets of data. (line 93) * gcry_ac_data_get_index: Working with sets of data. (line 69) * gcry_ac_data_get_name: Working with sets of data. (line 61) * gcry_ac_data_length: Working with sets of data. (line 57) * gcry_ac_data_new: Working with sets of data. (line 38) * gcry_ac_data_set: Working with sets of data. (line 45) * gcry_ac_data_sign: Using cryptographic functions. (line 48) * gcry_ac_data_sign_scheme: Using cryptographic functions. (line 147) * gcry_ac_data_t: Working with sets of data. (line 20) * gcry_ac_data_to_sexp: Working with sets of data. (line 79) * gcry_ac_data_verify: Using cryptographic functions. (line 54) * gcry_ac_data_verify_scheme: Using cryptographic functions. (line 157) * gcry_ac_id_t: Available asymmetric algorithms. (line 11) * gcry_ac_id_to_name: Handle-independent functions. (line 10) * gcry_ac_io_init: Working with IO objects. (line 22) * gcry_ac_io_init_va: Working with IO objects. (line 28) * gcry_ac_io_t: Working with IO objects. (line 10) * gcry_ac_key_data_get: Working with keys. (line 93) * gcry_ac_key_destroy: Working with keys. (line 86) * gcry_ac_key_get_grip: Working with keys. (line 105) * gcry_ac_key_get_nbits: Working with keys. (line 101) * gcry_ac_key_init: Working with keys. (line 30) * gcry_ac_key_pair_destroy: Working with keys. (line 90) * gcry_ac_key_pair_extract: Working with keys. (line 83) * gcry_ac_key_pair_generate: Working with keys. (line 36) * gcry_ac_key_pair_t: Working with keys. (line 20) * gcry_ac_key_t: Working with keys. (line 16) * gcry_ac_key_test: Working with keys. (line 97) * gcry_ac_key_type_t: Working with keys. (line 7) * gcry_ac_name_to_id: Handle-independent functions. (line 15) * gcry_ac_open: Working with handles. (line 11) * gcry_calloc: Memory allocation. (line 15) * gcry_calloc_secure: Memory allocation. (line 21) * gcry_check_version: Initializing the library. (line 17) * gcry_cipher_algo_info: General cipher functions. (line 12) * gcry_cipher_algo_name: General cipher functions. (line 39) * gcry_cipher_close: Working with cipher handles. (line 59) * gcry_cipher_ctl: Working with cipher handles. (line 157) * gcry_cipher_decrypt: Working with cipher handles. (line 127) * gcry_cipher_decrypt_t: Cipher modules. (line 80) * gcry_cipher_encrypt: Working with cipher handles. (line 108) * gcry_cipher_encrypt_t: Cipher modules. (line 75) * gcry_cipher_info: Working with cipher handles. (line 166) * gcry_cipher_list: Cipher modules. (line 106) * gcry_cipher_map_name: General cipher functions. (line 45) * gcry_cipher_mode_from_oid: General cipher functions. (line 50) * gcry_cipher_oid_spec_t: Cipher modules. (line 60) * gcry_cipher_open: Working with cipher handles. (line 11) * gcry_cipher_register: Cipher modules. (line 96) * gcry_cipher_reset: Working with cipher handles. (line 95) * gcry_cipher_setctr: Working with cipher handles. (line 88) * gcry_cipher_setiv: Working with cipher handles. (line 81) * gcry_cipher_setkey: Working with cipher handles. (line 66) * gcry_cipher_setkey_t: Cipher modules. (line 70) * gcry_cipher_spec_t: Cipher modules. (line 12) * gcry_cipher_stdecrypt_t: Cipher modules. (line 90) * gcry_cipher_stencrypt_t: Cipher modules. (line 85) * gcry_cipher_sync: Working with cipher handles. (line 147) * gcry_cipher_unregister: Cipher modules. (line 101) * gcry_control: Controlling the library. (line 7) * gcry_create_nonce: Retrieving random numbers. (line 26) * gcry_err_code: Error Values. (line 43) * gcry_err_code_from_errno: Error Values. (line 95) * gcry_err_code_t: Error Values. (line 7) * gcry_err_code_to_errno: Error Values. (line 100) * gcry_err_make: Error Values. (line 57) * gcry_err_make_from_errno: Error Values. (line 81) * gcry_err_source: Error Values. (line 49) * gcry_err_source_t: Error Values. (line 14) * gcry_error: Error Values. (line 64) * gcry_error_from_errno: Error Values. (line 86) * gcry_error_t: Error Values. (line 25) * gcry_fips_mode_active: Controlling the library. (line 221) * gcry_free: Memory allocation. (line 31) * gcry_handler_alloc_t: Allocation handler. (line 12) * gcry_handler_error_t: Error handler. (line 27) * gcry_handler_free_t: Allocation handler. (line 24) * gcry_handler_log_t: Logging handler. (line 7) * gcry_handler_no_mem_t: Error handler. (line 11) * gcry_handler_progress_t: Progress handler. (line 10) * gcry_handler_realloc_t: Allocation handler. (line 20) * gcry_handler_secure_check_t: Allocation handler. (line 16) * gcry_malloc: Memory allocation. (line 7) * gcry_malloc_secure: Memory allocation. (line 12) * gcry_md_algo_name: Working with hash algorithms. (line 152) * gcry_md_close: Working with hash algorithms. (line 61) * gcry_md_copy: Working with hash algorithms. (line 82) * gcry_md_debug: Working with hash algorithms. (line 216) * gcry_md_enable: Working with hash algorithms. (line 44) * gcry_md_final: Working with hash algorithms. (line 110) * gcry_md_final_t: Hash algorithm modules. (line 73) * gcry_md_get_algo: Working with hash algorithms. (line 196) * gcry_md_get_algo_dlen: Working with hash algorithms. (line 187) * gcry_md_get_asnoid: Working with hash algorithms. (line 168) * gcry_md_hash_buffer: Working with hash algorithms. (line 135) * gcry_md_init_t: Hash algorithm modules. (line 65) * gcry_md_is_enabled: Working with hash algorithms. (line 207) * gcry_md_is_secure: Working with hash algorithms. (line 202) * gcry_md_list: Hash algorithm modules. (line 91) * gcry_md_map_name: Working with hash algorithms. (line 158) * gcry_md_oid_spec_t: Hash algorithm modules. (line 57) * gcry_md_open: Working with hash algorithms. (line 11) * gcry_md_putc: Working with hash algorithms. (line 100) * gcry_md_read: Working with hash algorithms. (line 120) * gcry_md_read_t: Hash algorithm modules. (line 77) * gcry_md_register: Hash algorithm modules. (line 82) * gcry_md_reset: Working with hash algorithms. (line 70) * gcry_md_setkey: Working with hash algorithms. (line 53) * gcry_md_spec_t: Hash algorithm modules. (line 12) * gcry_md_start_debug: Working with hash algorithms. (line 230) * gcry_md_stop_debug: Working with hash algorithms. (line 238) * gcry_md_test_algo: Working with hash algorithms. (line 181) * gcry_md_unregister: Hash algorithm modules. (line 87) * gcry_md_write: Working with hash algorithms. (line 95) * gcry_md_write_t: Hash algorithm modules. (line 69) * gcry_module_t: Modules. (line 10) * gcry_mpi_add: Calculations. (line 10) * gcry_mpi_add_ui: Calculations. (line 14) * gcry_mpi_addm: Calculations. (line 18) * gcry_mpi_aprint: MPI formats. (line 54) * gcry_mpi_clear_bit: Bit manipulations. (line 19) * gcry_mpi_clear_flag: Miscellaneous. (line 32) * gcry_mpi_clear_highbit: Bit manipulations. (line 25) * gcry_mpi_cmp: Comparisons. (line 9) * gcry_mpi_cmp_ui: Comparisons. (line 13) * gcry_mpi_copy: Basic functions. (line 23) * gcry_mpi_div: Calculations. (line 50) * gcry_mpi_dump: MPI formats. (line 61) * gcry_mpi_gcd: Calculations. (line 63) * gcry_mpi_get_flag: Miscellaneous. (line 37) * gcry_mpi_get_nbits: Bit manipulations. (line 10) * gcry_mpi_get_opaque: Miscellaneous. (line 20) * gcry_mpi_invm: Calculations. (line 68) * gcry_mpi_lshift: Bit manipulations. (line 34) * gcry_mpi_mod: Calculations. (line 55) * gcry_mpi_mul: Calculations. (line 34) * gcry_mpi_mul_2exp: Calculations. (line 46) * gcry_mpi_mul_ui: Calculations. (line 38) * gcry_mpi_mulm: Calculations. (line 42) * gcry_mpi_new: Basic functions. (line 10) * gcry_mpi_powm: Calculations. (line 59) * gcry_mpi_print: MPI formats. (line 45) * gcry_mpi_randomize: Miscellaneous. (line 41) * gcry_mpi_release: Basic functions. (line 26) * gcry_mpi_rshift: Bit manipulations. (line 29) * gcry_mpi_scan: MPI formats. (line 12) * gcry_mpi_set: Basic functions. (line 33) * gcry_mpi_set_bit: Bit manipulations. (line 16) * gcry_mpi_set_flag: Miscellaneous. (line 26) * gcry_mpi_set_highbit: Bit manipulations. (line 22) * gcry_mpi_set_opaque: Miscellaneous. (line 8) * gcry_mpi_set_ui: Basic functions. (line 37) * gcry_mpi_snew: Basic functions. (line 17) * gcry_mpi_sub: Calculations. (line 22) * gcry_mpi_sub_ui: Calculations. (line 26) * gcry_mpi_subm: Calculations. (line 30) * gcry_mpi_swap: Basic functions. (line 44) * gcry_mpi_t: Data types. (line 7) * gcry_mpi_test_bit: Bit manipulations. (line 13) * gcry_pk_algo_info: General public-key related Functions. (line 47) * gcry_pk_algo_name: General public-key related Functions. (line 10) * gcry_pk_check_secret_key_t: Public key modules. (line 91) * gcry_pk_ctl: General public-key related Functions. (line 100) * gcry_pk_decrypt: Cryptographic Functions. (line 85) * gcry_pk_decrypt_t: Public key modules. (line 101) * gcry_pk_encrypt: Cryptographic Functions. (line 29) * gcry_pk_encrypt_t: Public key modules. (line 96) * gcry_pk_generate_t: Public key modules. (line 86) * gcry_pk_genkey: General public-key related Functions. (line 115) * gcry_pk_get_keygrip: General public-key related Functions. (line 29) * gcry_pk_get_nbits: General public-key related Functions. (line 24) * gcry_pk_get_nbits_t: Public key modules. (line 116) * gcry_pk_list: Public key modules. (line 131) * gcry_pk_map_name: General public-key related Functions. (line 16) * gcry_pk_register: Public key modules. (line 121) * gcry_pk_sign: Cryptographic Functions. (line 117) * gcry_pk_sign_t: Public key modules. (line 106) * gcry_pk_spec_t: Public key modules. (line 12) * gcry_pk_test_algo: General public-key related Functions. (line 20) * gcry_pk_testkey: General public-key related Functions. (line 40) * gcry_pk_unregister: Public key modules. (line 127) * gcry_pk_verify: Cryptographic Functions. (line 170) * gcry_pk_verify_t: Public key modules. (line 111) * gcry_prime_check: Checking. (line 8) * gcry_prime_generate: Generation. (line 10) * gcry_prime_group_generator: Generation. (line 19) * gcry_prime_release_factors: Generation. (line 25) * gcry_random_bytes: Retrieving random numbers. (line 13) * gcry_random_bytes_secure: Retrieving random numbers. (line 19) * gcry_random_level_t: Quality of random numbers. (line 9) * gcry_randomize: Retrieving random numbers. (line 8) * gcry_realloc: Memory allocation. (line 24) * gcry_set_allocation_handler: Allocation handler. (line 34) * gcry_set_fatalerror_handler: Error handler. (line 32) * gcry_set_log_handler: Logging handler. (line 12) * gcry_set_outofcore_handler: Error handler. (line 16) * gcry_set_progress_handler: Progress handler. (line 21) * gcry_sexp_build: Working with S-expressions. (line 43) * gcry_sexp_canon_len: Working with S-expressions. (line 116) * gcry_sexp_car: Working with S-expressions. (line 146) * gcry_sexp_cdr: Working with S-expressions. (line 151) * gcry_sexp_create: Working with S-expressions. (line 26) * gcry_sexp_dump: Working with S-expressions. (line 107) * gcry_sexp_find_token: Working with S-expressions. (line 129) * gcry_sexp_length: Working with S-expressions. (line 136) * gcry_sexp_new: Working with S-expressions. (line 13) * gcry_sexp_nth: Working with S-expressions. (line 141) * gcry_sexp_nth_data: Working with S-expressions. (line 159) * gcry_sexp_nth_mpi: Working with S-expressions. (line 184) * gcry_sexp_nth_string: Working with S-expressions. (line 176) * gcry_sexp_release: Working with S-expressions. (line 76) * gcry_sexp_sprint: Working with S-expressions. (line 84) * gcry_sexp_sscan: Working with S-expressions. (line 37) * gcry_sexp_t: Data types for S-expressions. (line 7) * gcry_strerror: Error Strings. (line 7) * gcry_strsource: Error Strings. (line 13)  Tag Table: Node: Top773 Node: Introduction2990 Node: Getting Started3362 Node: Features4243 Node: Overview5027 Node: Preparation5658 Node: Header6515 Node: Building sources7585 Node: Building sources using Automake9499 Node: Initializing the library10681 Ref: sample-use-suspend-secmem13856 Ref: sample-use-resume-secmem14476 Node: Multi-Threading15372 Ref: Multi-Threading-Footnote-119385 Node: Enabling FIPS mode19793 Node: Generalities21659 Node: Controlling the library21984 Node: Modules34151 Node: Error Handling34930 Node: Error Values37453 Node: Error Sources42393 Node: Error Codes44664 Node: Error Strings48149 Node: Handler Functions49332 Node: Progress handler49891 Node: Allocation handler51887 Node: Error handler53438 Node: Logging handler55005 Node: Symmetric cryptography55597 Node: Available ciphers56402 Node: Cipher modules58909 Node: Available cipher modes63433 Node: Working with cipher handles64312 Node: General cipher functions72515 Node: Public Key cryptography75033 Node: Available algorithms75948 Node: Used S-expressions76297 Node: RSA key parameters77409 Node: DSA key parameters78684 Node: ECC key parameters79342 Node: Public key modules81107 Node: Cryptographic Functions86691 Node: General public-key related Functions94178 Node: AC Interface106467 Node: Available asymmetric algorithms107602 Node: Working with sets of data108271 Node: Working with IO objects112773 Node: Working with handles115493 Node: Working with keys116440 Node: Using cryptographic functions120522 Node: Handle-independent functions127429 Node: Hashing128177 Node: Available hash algorithms128968 Node: Hash algorithm modules131205 Node: Working with hash algorithms135053 Node: Random Numbers146257 Node: Quality of random numbers146531 Node: Retrieving random numbers147215 Node: S-expressions148699 Node: Data types for S-expressions149341 Node: Working with S-expressions149665 Node: MPI library158598 Node: Data types159556 Node: Basic functions159750 Node: MPI formats161818 Node: Calculations164701 Node: Comparisons166955 Node: Bit manipulations167599 Node: Miscellaneous168914 Node: Prime numbers170883 Node: Generation171153 Node: Checking172437 Node: Utilities172850 Node: Memory allocation173043 Node: Architecture174304 Ref: fig:subsystems175824 Ref: Architecture-Footnote-1176909 Ref: Architecture-Footnote-2176971 Node: Public-Key Subsystem Architecture177055 Node: Symmetric Encryption Subsystem Architecture179996 Node: Hashing and MACing Subsystem Architecture181443 Node: Multi-Precision-Integer Subsystem Architecture183367 Node: Prime-Number-Generator Subsystem Architecture184808 Ref: Prime-Number-Generator Subsystem Architecture-Footnote-1186739 Node: Random-Number Subsystem Architecture187026 Node: CSPRNG Description189515 Ref: CSPRNG Description-Footnote-1191077 Node: FIPS PRNG Description191200 Node: Self-Tests193335 Node: FIPS Mode205019 Ref: fig:fips-fsm208999 Ref: tbl:fips-states209101 Ref: tbl:fips-state-transitions210354 Node: Library Copying213968 Node: Copying242086 Node: Figures and Tables261260 Node: Concept Index261670 Node: Function and Data Index267235  End Tag Table ./libgcrypt-1.4.4-i686/usr/local/share/aclocal/0000755000000000000000000000000011237045211017443 5ustar rootroot./libgcrypt-1.4.4-i686/usr/local/share/aclocal/libgcrypt.m40000644000000000000000000001015511237045207021713 0ustar rootrootdnl Autoconf macros for libgcrypt dnl Copyright (C) 2002, 2004 Free Software Foundation, Inc. dnl dnl This file is free software; as a special exception the author gives dnl unlimited permission to copy and/or distribute it, with or without dnl modifications, as long as this notice is preserved. dnl dnl This file is distributed in the hope that it will be useful, but dnl WITHOUT ANY WARRANTY, to the extent permitted by law; without even the dnl implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. dnl AM_PATH_LIBGCRYPT([MINIMUM-VERSION, dnl [ACTION-IF-FOUND [, ACTION-IF-NOT-FOUND ]]]) dnl Test for libgcrypt and define LIBGCRYPT_CFLAGS and LIBGCRYPT_LIBS. dnl MINIMUN-VERSION is a string with the version number optionalliy prefixed dnl with the API version to also check the API compatibility. Example: dnl a MINIMUN-VERSION of 1:1.2.5 won't pass the test unless the installed dnl version of libgcrypt is at least 1.2.5 *and* the API number is 1. Using dnl this features allows to prevent build against newer versions of libgcrypt dnl with a changed API. dnl AC_DEFUN([AM_PATH_LIBGCRYPT], [ AC_ARG_WITH(libgcrypt-prefix, AC_HELP_STRING([--with-libgcrypt-prefix=PFX], [prefix where LIBGCRYPT is installed (optional)]), libgcrypt_config_prefix="$withval", libgcrypt_config_prefix="") if test x$libgcrypt_config_prefix != x ; then if test x${LIBGCRYPT_CONFIG+set} != xset ; then LIBGCRYPT_CONFIG=$libgcrypt_config_prefix/bin/libgcrypt-config fi fi AC_PATH_PROG(LIBGCRYPT_CONFIG, libgcrypt-config, no) tmp=ifelse([$1], ,1:1.2.0,$1) if echo "$tmp" | grep ':' >/dev/null 2>/dev/null ; then req_libgcrypt_api=`echo "$tmp" | sed 's/\(.*\):\(.*\)/\1/'` min_libgcrypt_version=`echo "$tmp" | sed 's/\(.*\):\(.*\)/\2/'` else req_libgcrypt_api=0 min_libgcrypt_version="$tmp" fi AC_MSG_CHECKING(for LIBGCRYPT - version >= $min_libgcrypt_version) ok=no if test "$LIBGCRYPT_CONFIG" != "no" ; then req_major=`echo $min_libgcrypt_version | \ sed 's/\([[0-9]]*\)\.\([[0-9]]*\)\.\([[0-9]]*\)/\1/'` req_minor=`echo $min_libgcrypt_version | \ sed 's/\([[0-9]]*\)\.\([[0-9]]*\)\.\([[0-9]]*\)/\2/'` req_micro=`echo $min_libgcrypt_version | \ sed 's/\([[0-9]]*\)\.\([[0-9]]*\)\.\([[0-9]]*\)/\3/'` libgcrypt_config_version=`$LIBGCRYPT_CONFIG --version` major=`echo $libgcrypt_config_version | \ sed 's/\([[0-9]]*\)\.\([[0-9]]*\)\.\([[0-9]]*\).*/\1/'` minor=`echo $libgcrypt_config_version | \ sed 's/\([[0-9]]*\)\.\([[0-9]]*\)\.\([[0-9]]*\).*/\2/'` micro=`echo $libgcrypt_config_version | \ sed 's/\([[0-9]]*\)\.\([[0-9]]*\)\.\([[0-9]]*\).*/\3/'` if test "$major" -gt "$req_major"; then ok=yes else if test "$major" -eq "$req_major"; then if test "$minor" -gt "$req_minor"; then ok=yes else if test "$minor" -eq "$req_minor"; then if test "$micro" -ge "$req_micro"; then ok=yes fi fi fi fi fi fi if test $ok = yes; then AC_MSG_RESULT([yes ($libgcrypt_config_version)]) else AC_MSG_RESULT(no) fi if test $ok = yes; then # If we have a recent libgcrypt, we should also check that the # API is compatible if test "$req_libgcrypt_api" -gt 0 ; then tmp=`$LIBGCRYPT_CONFIG --api-version 2>/dev/null || echo 0` if test "$tmp" -gt 0 ; then AC_MSG_CHECKING([LIBGCRYPT API version]) if test "$req_libgcrypt_api" -eq "$tmp" ; then AC_MSG_RESULT([okay]) else ok=no AC_MSG_RESULT([does not match. want=$req_libgcrypt_api got=$tmp]) fi fi fi fi if test $ok = yes; then LIBGCRYPT_CFLAGS=`$LIBGCRYPT_CONFIG --cflags` LIBGCRYPT_LIBS=`$LIBGCRYPT_CONFIG --libs` ifelse([$2], , :, [$2]) else LIBGCRYPT_CFLAGS="" LIBGCRYPT_LIBS="" ifelse([$3], , :, [$3]) fi AC_SUBST(LIBGCRYPT_CFLAGS) AC_SUBST(LIBGCRYPT_LIBS) ]) ./libgcrypt-1.4.4-i686/usr/local/include/0000755000000000000000000000000011237045211016366 5ustar rootroot./libgcrypt-1.4.4-i686/usr/local/include/gcrypt.h0000644000000000000000000021160311237045207020057 0ustar rootroot/* gcrypt.h - GNU Cryptographic Library Interface -*- c -*- Copyright (C) 1998, 1999, 2000, 2001, 2002, 2003, 2004, 2006 2007, 2008, 2009 Free Software Foundation, Inc. This file is part of Libgcrypt. Libgcrypt is free software; you can redistribute it and/or modify it under the terms of the GNU Lesser General Public License as published by the Free Software Foundation; either version 2.1 of the License, or (at your option) any later version. Libgcrypt is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Lesser General Public License for more details. You should have received a copy of the GNU Lesser General Public License along with this program; if not, see . File: src/gcrypt.h. Generated from gcrypt.h.in by configure. */ #ifndef _GCRYPT_H #define _GCRYPT_H #include #include #include #include #include #if defined _WIN32 || defined __WIN32__ # include # include #else # include #endif /*!_WIN32*/ typedef socklen_t gcry_socklen_t; #include /* This is required for error code compatibility. */ #define _GCRY_ERR_SOURCE_DEFAULT GPG_ERR_SOURCE_GCRYPT #ifdef __cplusplus extern "C" { #if 0 /* (Keep Emacsens' auto-indent happy.) */ } #endif #endif /* The version of this header should match the one of the library. It should not be used by a program because gcry_check_version() should return the same version. The purpose of this macro is to let autoconf (using the AM_PATH_GCRYPT macro) check that this header matches the installed library. */ #define GCRYPT_VERSION "1.4.4" /* Internal: We can't use the convenience macros for the multi precision integer functions when building this library. */ #ifdef _GCRYPT_IN_LIBGCRYPT #ifndef GCRYPT_NO_MPI_MACROS #define GCRYPT_NO_MPI_MACROS 1 #endif #endif /* We want to use gcc attributes when possible. Warning: Don't use these macros in your programs: As indicated by the leading underscore they are subject to change without notice. */ #ifdef __GNUC__ #define _GCRY_GCC_VERSION (__GNUC__ * 10000 \ + __GNUC_MINOR__ * 100 \ + __GNUC_PATCHLEVEL__) #if _GCRY_GCC_VERSION >= 30100 #define _GCRY_GCC_ATTR_DEPRECATED __attribute__ ((__deprecated__)) #endif #if _GCRY_GCC_VERSION >= 29600 #define _GCRY_GCC_ATTR_PURE __attribute__ ((__pure__)) #endif #if _GCRY_GCC_VERSION >= 30200 #define _GCRY_GCC_ATTR_MALLOC __attribute__ ((__malloc__)) #endif #endif /*__GNUC__*/ #ifndef _GCRY_GCC_ATTR_DEPRECATED #define _GCRY_GCC_ATTR_DEPRECATED #endif #ifndef _GCRY_GCC_ATTR_PURE #define _GCRY_GCC_ATTR_PURE #endif #ifndef _GCRY_GCC_ATTR_MALLOC #define _GCRY_GCC_ATTR_MALLOC #endif /* Some members in a public type should only be used internally. There is no "internal" attribute, so we abuse the deprecated attribute to discourage external use. */ #ifdef _GCRYPT_IN_LIBGCRYPT #define _GCRY_ATTR_INTERNAL #else #define _GCRY_ATTR_INTERNAL _GCRY_GCC_ATTR_DEPRECATED #endif /* Wrappers for the libgpg-error library. */ typedef gpg_error_t gcry_error_t; typedef gpg_err_code_t gcry_err_code_t; typedef gpg_err_source_t gcry_err_source_t; static GPG_ERR_INLINE gcry_error_t gcry_err_make (gcry_err_source_t source, gcry_err_code_t code) { return gpg_err_make (source, code); } /* The user can define GPG_ERR_SOURCE_DEFAULT before including this file to specify a default source for gpg_error. */ #ifndef GCRY_ERR_SOURCE_DEFAULT #define GCRY_ERR_SOURCE_DEFAULT GPG_ERR_SOURCE_USER_1 #endif static GPG_ERR_INLINE gcry_error_t gcry_error (gcry_err_code_t code) { return gcry_err_make (GCRY_ERR_SOURCE_DEFAULT, code); } static GPG_ERR_INLINE gcry_err_code_t gcry_err_code (gcry_error_t err) { return gpg_err_code (err); } static GPG_ERR_INLINE gcry_err_source_t gcry_err_source (gcry_error_t err) { return gpg_err_source (err); } /* Return a pointer to a string containing a description of the error code in the error value ERR. */ const char *gcry_strerror (gcry_error_t err); /* Return a pointer to a string containing a description of the error source in the error value ERR. */ const char *gcry_strsource (gcry_error_t err); /* Retrieve the error code for the system error ERR. This returns GPG_ERR_UNKNOWN_ERRNO if the system error is not mapped (report this). */ gcry_err_code_t gcry_err_code_from_errno (int err); /* Retrieve the system error for the error code CODE. This returns 0 if CODE is not a system error code. */ int gcry_err_code_to_errno (gcry_err_code_t code); /* Return an error value with the error source SOURCE and the system error ERR. */ gcry_error_t gcry_err_make_from_errno (gcry_err_source_t source, int err); /* Return an error value with the system error ERR. */ gcry_err_code_t gcry_error_from_errno (int err); /* This enum is deprecated; it is only declared for the sake of complete API compatibility. */ enum gcry_thread_option { _GCRY_THREAD_OPTION_DUMMY } _GCRY_GCC_ATTR_DEPRECATED; /* Constants defining the thread model to use. Used with the OPTION field of the struct gcry_thread_cbs. */ #define GCRY_THREAD_OPTION_DEFAULT 0 #define GCRY_THREAD_OPTION_USER 1 #define GCRY_THREAD_OPTION_PTH 2 #define GCRY_THREAD_OPTION_PTHREAD 3 /* The version number encoded in the OPTION field of the struct gcry_thread_cbs. */ #define GCRY_THREAD_OPTION_VERSION 0 /* Wrapper for struct ath_ops. */ struct gcry_thread_cbs { /* The OPTION field encodes the thread model and the version number of this structure. Bits 7 - 0 are used for the thread model Bits 15 - 8 are used for the version number. */ unsigned int option; int (*init) (void); int (*mutex_init) (void **priv); int (*mutex_destroy) (void **priv); int (*mutex_lock) (void **priv); int (*mutex_unlock) (void **priv); ssize_t (*read) (int fd, void *buf, size_t nbytes); ssize_t (*write) (int fd, const void *buf, size_t nbytes); #ifdef _WIN32 ssize_t (*select) (int nfd, void *rset, void *wset, void *eset, struct timeval *timeout); ssize_t (*waitpid) (pid_t pid, int *status, int options); int (*accept) (int s, void *addr, int *length_ptr); int (*connect) (int s, void *addr, gcry_socklen_t length); int (*sendmsg) (int s, const void *msg, int flags); int (*recvmsg) (int s, void *msg, int flags); #else ssize_t (*select) (int nfd, fd_set *rset, fd_set *wset, fd_set *eset, struct timeval *timeout); ssize_t (*waitpid) (pid_t pid, int *status, int options); int (*accept) (int s, struct sockaddr *addr, gcry_socklen_t *length_ptr); int (*connect) (int s, struct sockaddr *addr, gcry_socklen_t length); int (*sendmsg) (int s, const struct msghdr *msg, int flags); int (*recvmsg) (int s, struct msghdr *msg, int flags); #endif }; #ifdef _WIN32 # define _GCRY_THREAD_OPTION_PTH_IMPL_NET \ static ssize_t gcry_pth_select (int nfd, void *rset, void *wset, \ void *eset, struct timeval *timeout) \ { return pth_select (nfd, rset, wset, eset, timeout); } \ static ssize_t gcry_pth_waitpid (pid_t pid, int *status, int options) \ { return pth_waitpid (pid, status, options); } \ static int gcry_pth_accept (int s, void *addr, \ gcry_socklen_t *length_ptr) \ { return pth_accept (s, addr, length_ptr); } \ static int gcry_pth_connect (int s, void *addr, \ gcry_socklen_t length) \ { return pth_connect (s, addr, length); } #else /*!_WIN32*/ # define _GCRY_THREAD_OPTION_PTH_IMPL_NET \ static ssize_t gcry_pth_select (int nfd, fd_set *rset, fd_set *wset, \ fd_set *eset, struct timeval *timeout) \ { return pth_select (nfd, rset, wset, eset, timeout); } \ static ssize_t gcry_pth_waitpid (pid_t pid, int *status, int options) \ { return pth_waitpid (pid, status, options); } \ static int gcry_pth_accept (int s, struct sockaddr *addr, \ gcry_socklen_t *length_ptr) \ { return pth_accept (s, addr, length_ptr); } \ static int gcry_pth_connect (int s, struct sockaddr *addr, \ gcry_socklen_t length) \ { return pth_connect (s, addr, length); } #endif /*!_WIN32*/ #define GCRY_THREAD_OPTION_PTH_IMPL \ static int gcry_pth_init (void) \ { return (pth_init () == FALSE) ? errno : 0; } \ static int gcry_pth_mutex_init (void **priv) \ { \ int err = 0; \ pth_mutex_t *lock = malloc (sizeof (pth_mutex_t)); \ \ if (!lock) \ err = ENOMEM; \ if (!err) \ { \ err = pth_mutex_init (lock); \ if (err == FALSE) \ err = errno; \ else \ err = 0; \ if (err) \ free (lock); \ else \ *priv = lock; \ } \ return err; \ } \ static int gcry_pth_mutex_destroy (void **lock) \ { /* GNU Pth has no destructor function. */ free (*lock); return 0; } \ static int gcry_pth_mutex_lock (void **lock) \ { return ((pth_mutex_acquire (*lock, 0, NULL)) == FALSE) \ ? errno : 0; } \ static int gcry_pth_mutex_unlock (void **lock) \ { return ((pth_mutex_release (*lock)) == FALSE) \ ? errno : 0; } \ static ssize_t gcry_pth_read (int fd, void *buf, size_t nbytes) \ { return pth_read (fd, buf, nbytes); } \ static ssize_t gcry_pth_write (int fd, const void *buf, size_t nbytes) \ { return pth_write (fd, buf, nbytes); } \ _GCRY_THREAD_OPTION_PTH_IMPL_NET \ \ /* Note: GNU Pth is missing pth_sendmsg and pth_recvmsg. */ \ static struct gcry_thread_cbs gcry_threads_pth = { \ (GCRY_THREAD_OPTION_PTH | (GCRY_THREAD_OPTION_VERSION << 8)), \ gcry_pth_init, gcry_pth_mutex_init, gcry_pth_mutex_destroy, \ gcry_pth_mutex_lock, gcry_pth_mutex_unlock, gcry_pth_read, gcry_pth_write, \ gcry_pth_select, gcry_pth_waitpid, gcry_pth_accept, gcry_pth_connect, \ NULL, NULL } #define GCRY_THREAD_OPTION_PTHREAD_IMPL \ static int gcry_pthread_mutex_init (void **priv) \ { \ int err = 0; \ pthread_mutex_t *lock = (pthread_mutex_t*)malloc (sizeof (pthread_mutex_t));\ \ if (!lock) \ err = ENOMEM; \ if (!err) \ { \ err = pthread_mutex_init (lock, NULL); \ if (err) \ free (lock); \ else \ *priv = lock; \ } \ return err; \ } \ static int gcry_pthread_mutex_destroy (void **lock) \ { int err = pthread_mutex_destroy ((pthread_mutex_t*)*lock); \ free (*lock); return err; } \ static int gcry_pthread_mutex_lock (void **lock) \ { return pthread_mutex_lock ((pthread_mutex_t*)*lock); } \ static int gcry_pthread_mutex_unlock (void **lock) \ { return pthread_mutex_unlock ((pthread_mutex_t*)*lock); } \ \ static struct gcry_thread_cbs gcry_threads_pthread = { \ (GCRY_THREAD_OPTION_PTHREAD | (GCRY_THREAD_OPTION_VERSION << 8)), \ NULL, gcry_pthread_mutex_init, gcry_pthread_mutex_destroy, \ gcry_pthread_mutex_lock, gcry_pthread_mutex_unlock, \ NULL, NULL, NULL, NULL, NULL, NULL, NULL, NULL } /* The data object used to hold a multi precision integer. */ struct gcry_mpi; typedef struct gcry_mpi *gcry_mpi_t; #ifndef GCRYPT_NO_DEPRECATED typedef struct gcry_mpi *GCRY_MPI _GCRY_GCC_ATTR_DEPRECATED; typedef struct gcry_mpi *GcryMPI _GCRY_GCC_ATTR_DEPRECATED; #endif /* Check that the library fulfills the version requirement. */ const char *gcry_check_version (const char *req_version); /* Codes for function dispatchers. */ /* Codes used with the gcry_control function. */ enum gcry_ctl_cmds { GCRYCTL_SET_KEY = 1, GCRYCTL_SET_IV = 2, GCRYCTL_CFB_SYNC = 3, GCRYCTL_RESET = 4, /* e.g. for MDs */ GCRYCTL_FINALIZE = 5, GCRYCTL_GET_KEYLEN = 6, GCRYCTL_GET_BLKLEN = 7, GCRYCTL_TEST_ALGO = 8, GCRYCTL_IS_SECURE = 9, GCRYCTL_GET_ASNOID = 10, GCRYCTL_ENABLE_ALGO = 11, GCRYCTL_DISABLE_ALGO = 12, GCRYCTL_DUMP_RANDOM_STATS = 13, GCRYCTL_DUMP_SECMEM_STATS = 14, GCRYCTL_GET_ALGO_NPKEY = 15, GCRYCTL_GET_ALGO_NSKEY = 16, GCRYCTL_GET_ALGO_NSIGN = 17, GCRYCTL_GET_ALGO_NENCR = 18, GCRYCTL_SET_VERBOSITY = 19, GCRYCTL_SET_DEBUG_FLAGS = 20, GCRYCTL_CLEAR_DEBUG_FLAGS = 21, GCRYCTL_USE_SECURE_RNDPOOL= 22, GCRYCTL_DUMP_MEMORY_STATS = 23, GCRYCTL_INIT_SECMEM = 24, GCRYCTL_TERM_SECMEM = 25, GCRYCTL_DISABLE_SECMEM_WARN = 27, GCRYCTL_SUSPEND_SECMEM_WARN = 28, GCRYCTL_RESUME_SECMEM_WARN = 29, GCRYCTL_DROP_PRIVS = 30, GCRYCTL_ENABLE_M_GUARD = 31, GCRYCTL_START_DUMP = 32, GCRYCTL_STOP_DUMP = 33, GCRYCTL_GET_ALGO_USAGE = 34, GCRYCTL_IS_ALGO_ENABLED = 35, GCRYCTL_DISABLE_INTERNAL_LOCKING = 36, GCRYCTL_DISABLE_SECMEM = 37, GCRYCTL_INITIALIZATION_FINISHED = 38, GCRYCTL_INITIALIZATION_FINISHED_P = 39, GCRYCTL_ANY_INITIALIZATION_P = 40, GCRYCTL_SET_CBC_CTS = 41, GCRYCTL_SET_CBC_MAC = 42, GCRYCTL_SET_CTR = 43, GCRYCTL_ENABLE_QUICK_RANDOM = 44, GCRYCTL_SET_RANDOM_SEED_FILE = 45, GCRYCTL_UPDATE_RANDOM_SEED_FILE = 46, GCRYCTL_SET_THREAD_CBS = 47, GCRYCTL_FAST_POLL = 48, GCRYCTL_SET_RANDOM_DAEMON_SOCKET = 49, GCRYCTL_USE_RANDOM_DAEMON = 50, GCRYCTL_FAKED_RANDOM_P = 51, GCRYCTL_SET_RNDEGD_SOCKET = 52, GCRYCTL_PRINT_CONFIG = 53, GCRYCTL_OPERATIONAL_P = 54, GCRYCTL_FIPS_MODE_P = 55, GCRYCTL_FORCE_FIPS_MODE = 56, GCRYCTL_SELFTEST = 57 /* Note: 58 .. 62 are used internally. */ }; /* Perform various operations defined by CMD. */ gcry_error_t gcry_control (enum gcry_ctl_cmds CMD, ...); /* S-expression management. */ /* The object to represent an S-expression as used with the public key functions. */ struct gcry_sexp; typedef struct gcry_sexp *gcry_sexp_t; #ifndef GCRYPT_NO_DEPRECATED typedef struct gcry_sexp *GCRY_SEXP _GCRY_GCC_ATTR_DEPRECATED; typedef struct gcry_sexp *GcrySexp _GCRY_GCC_ATTR_DEPRECATED; #endif /* The possible values for the S-expression format. */ enum gcry_sexp_format { GCRYSEXP_FMT_DEFAULT = 0, GCRYSEXP_FMT_CANON = 1, GCRYSEXP_FMT_BASE64 = 2, GCRYSEXP_FMT_ADVANCED = 3 }; /* Create an new S-expression object from BUFFER of size LENGTH and return it in RETSEXP. With AUTODETECT set to 0 the data in BUFFER is expected to be in canonized format. */ gcry_error_t gcry_sexp_new (gcry_sexp_t *retsexp, const void *buffer, size_t length, int autodetect); /* Same as gcry_sexp_new but allows to pass a FREEFNC which has the effect to transfer ownership of BUFFER to the created object. */ gcry_error_t gcry_sexp_create (gcry_sexp_t *retsexp, void *buffer, size_t length, int autodetect, void (*freefnc) (void *)); /* Scan BUFFER and return a new S-expression object in RETSEXP. This function expects a printf like string in BUFFER. */ gcry_error_t gcry_sexp_sscan (gcry_sexp_t *retsexp, size_t *erroff, const char *buffer, size_t length); /* Same as gcry_sexp_sscan but expects a string in FORMAT and can thus only be used for certain encodings. */ gcry_error_t gcry_sexp_build (gcry_sexp_t *retsexp, size_t *erroff, const char *format, ...); /* Like gcry_sexp_build, but uses an array instead of variable function arguments. */ gcry_error_t gcry_sexp_build_array (gcry_sexp_t *retsexp, size_t *erroff, const char *format, void **arg_list); /* Release the S-expression object SEXP */ void gcry_sexp_release (gcry_sexp_t sexp); /* Calculate the length of an canonized S-expresion in BUFFER and check for a valid encoding. */ size_t gcry_sexp_canon_len (const unsigned char *buffer, size_t length, size_t *erroff, gcry_error_t *errcode); /* Copies the S-expression object SEXP into BUFFER using the format specified in MODE. */ size_t gcry_sexp_sprint (gcry_sexp_t sexp, int mode, void *buffer, size_t maxlength); /* Dumps the S-expression object A in a format suitable for debugging to Libgcrypt's logging stream. */ void gcry_sexp_dump (const gcry_sexp_t a); gcry_sexp_t gcry_sexp_cons (const gcry_sexp_t a, const gcry_sexp_t b); gcry_sexp_t gcry_sexp_alist (const gcry_sexp_t *array); gcry_sexp_t gcry_sexp_vlist (const gcry_sexp_t a, ...); gcry_sexp_t gcry_sexp_append (const gcry_sexp_t a, const gcry_sexp_t n); gcry_sexp_t gcry_sexp_prepend (const gcry_sexp_t a, const gcry_sexp_t n); /* Scan the S-expression for a sublist with a type (the car of the list) matching the string TOKEN. If TOKLEN is not 0, the token is assumed to be raw memory of this length. The function returns a newly allocated S-expression consisting of the found sublist or `NULL' when not found. */ gcry_sexp_t gcry_sexp_find_token (gcry_sexp_t list, const char *tok, size_t toklen); /* Return the length of the LIST. For a valid S-expression this should be at least 1. */ int gcry_sexp_length (const gcry_sexp_t list); /* Create and return a new S-expression from the element with index NUMBER in LIST. Note that the first element has the index 0. If there is no such element, `NULL' is returned. */ gcry_sexp_t gcry_sexp_nth (const gcry_sexp_t list, int number); /* Create and return a new S-expression from the first element in LIST; this called the "type" and should always exist and be a string. `NULL' is returned in case of a problem. */ gcry_sexp_t gcry_sexp_car (const gcry_sexp_t list); /* Create and return a new list form all elements except for the first one. Note, that this function may return an invalid S-expression because it is not guaranteed, that the type exists and is a string. However, for parsing a complex S-expression it might be useful for intermediate lists. Returns `NULL' on error. */ gcry_sexp_t gcry_sexp_cdr (const gcry_sexp_t list); gcry_sexp_t gcry_sexp_cadr (const gcry_sexp_t list); /* This function is used to get data from a LIST. A pointer to the actual data with index NUMBER is returned and the length of this data will be stored to DATALEN. If there is no data at the given index or the index represents another list, `NULL' is returned. *Note:* The returned pointer is valid as long as LIST is not modified or released. */ const char *gcry_sexp_nth_data (const gcry_sexp_t list, int number, size_t *datalen); /* This function is used to get and convert data from a LIST. The data is assumed to be a Nul terminated string. The caller must release the returned value using `gcry_free'. If there is no data at the given index, the index represents a list or the value can't be converted to a string, `NULL' is returned. */ char *gcry_sexp_nth_string (gcry_sexp_t list, int number); /* This function is used to get and convert data from a LIST. This data is assumed to be an MPI stored in the format described by MPIFMT and returned as a standard Libgcrypt MPI. The caller must release this returned value using `gcry_mpi_release'. If there is no data at the given index, the index represents a list or the value can't be converted to an MPI, `NULL' is returned. */ gcry_mpi_t gcry_sexp_nth_mpi (gcry_sexp_t list, int number, int mpifmt); /******************************************* * * * Multi Precision Integer Functions * * * *******************************************/ /* Different formats of external big integer representation. */ enum gcry_mpi_format { GCRYMPI_FMT_NONE= 0, GCRYMPI_FMT_STD = 1, /* Twos complement stored without length. */ GCRYMPI_FMT_PGP = 2, /* As used by OpenPGP (unsigned only). */ GCRYMPI_FMT_SSH = 3, /* As used by SSH (like STD but with length). */ GCRYMPI_FMT_HEX = 4, /* Hex format. */ GCRYMPI_FMT_USG = 5 /* Like STD but unsigned. */ }; /* Flags used for creating big integers. */ enum gcry_mpi_flag { GCRYMPI_FLAG_SECURE = 1, /* Allocate the number in "secure" memory. */ GCRYMPI_FLAG_OPAQUE = 2 /* The number is not a real one but just a way to store some bytes. This is useful for encrypted big integers. */ }; /* Allocate a new big integer object, initialize it with 0 and initially allocate memory for a number of at least NBITS. */ gcry_mpi_t gcry_mpi_new (unsigned int nbits); /* Same as gcry_mpi_new() but allocate in "secure" memory. */ gcry_mpi_t gcry_mpi_snew (unsigned int nbits); /* Release the number A and free all associated resources. */ void gcry_mpi_release (gcry_mpi_t a); /* Create a new number with the same value as A. */ gcry_mpi_t gcry_mpi_copy (const gcry_mpi_t a); /* Store the big integer value U in W. */ gcry_mpi_t gcry_mpi_set (gcry_mpi_t w, const gcry_mpi_t u); /* Store the unsigned integer value U in W. */ gcry_mpi_t gcry_mpi_set_ui (gcry_mpi_t w, unsigned long u); /* Swap the values of A and B. */ void gcry_mpi_swap (gcry_mpi_t a, gcry_mpi_t b); /* Compare the big integer number U and V returning 0 for equality, a positive value for U > V and a negative for U < V. */ int gcry_mpi_cmp (const gcry_mpi_t u, const gcry_mpi_t v); /* Compare the big integer number U with the unsigned integer V returning 0 for equality, a positive value for U > V and a negative for U < V. */ int gcry_mpi_cmp_ui (const gcry_mpi_t u, unsigned long v); /* Convert the external representation of an integer stored in BUFFER with a length of BUFLEN into a newly create MPI returned in RET_MPI. If NSCANNED is not NULL, it will receive the number of bytes actually scanned after a successful operation. */ gcry_error_t gcry_mpi_scan (gcry_mpi_t *ret_mpi, enum gcry_mpi_format format, const void *buffer, size_t buflen, size_t *nscanned); /* Convert the big integer A into the external representation described by FORMAT and store it in the provided BUFFER which has been allocated by the user with a size of BUFLEN bytes. NWRITTEN receives the actual length of the external representation unless it has been passed as NULL. */ gcry_error_t gcry_mpi_print (enum gcry_mpi_format format, unsigned char *buffer, size_t buflen, size_t *nwritten, const gcry_mpi_t a); /* Convert the big integer A int the external representation described by FORMAT and store it in a newly allocated buffer which address will be put into BUFFER. NWRITTEN receives the actual lengths of the external representation. */ gcry_error_t gcry_mpi_aprint (enum gcry_mpi_format format, unsigned char **buffer, size_t *nwritten, const gcry_mpi_t a); /* Dump the value of A in a format suitable for debugging to Libgcrypt's logging stream. Note that one leading space but no trailing space or linefeed will be printed. It is okay to pass NULL for A. */ void gcry_mpi_dump (const gcry_mpi_t a); /* W = U + V. */ void gcry_mpi_add (gcry_mpi_t w, gcry_mpi_t u, gcry_mpi_t v); /* W = U + V. V is an unsigned integer. */ void gcry_mpi_add_ui (gcry_mpi_t w, gcry_mpi_t u, unsigned long v); /* W = U + V mod M. */ void gcry_mpi_addm (gcry_mpi_t w, gcry_mpi_t u, gcry_mpi_t v, gcry_mpi_t m); /* W = U - V. */ void gcry_mpi_sub (gcry_mpi_t w, gcry_mpi_t u, gcry_mpi_t v); /* W = U - V. V is an unsigned integer. */ void gcry_mpi_sub_ui (gcry_mpi_t w, gcry_mpi_t u, unsigned long v ); /* W = U - V mod M */ void gcry_mpi_subm (gcry_mpi_t w, gcry_mpi_t u, gcry_mpi_t v, gcry_mpi_t m); /* W = U * V. */ void gcry_mpi_mul (gcry_mpi_t w, gcry_mpi_t u, gcry_mpi_t v); /* W = U * V. V is an unsigned integer. */ void gcry_mpi_mul_ui (gcry_mpi_t w, gcry_mpi_t u, unsigned long v ); /* W = U * V mod M. */ void gcry_mpi_mulm (gcry_mpi_t w, gcry_mpi_t u, gcry_mpi_t v, gcry_mpi_t m); /* W = U * (2 ^ CNT). */ void gcry_mpi_mul_2exp (gcry_mpi_t w, gcry_mpi_t u, unsigned long cnt); /* Q = DIVIDEND / DIVISOR, R = DIVIDEND % DIVISOR, Q or R may be passed as NULL. ROUND should be negative or 0. */ void gcry_mpi_div (gcry_mpi_t q, gcry_mpi_t r, gcry_mpi_t dividend, gcry_mpi_t divisor, int round); /* R = DIVIDEND % DIVISOR */ void gcry_mpi_mod (gcry_mpi_t r, gcry_mpi_t dividend, gcry_mpi_t divisor); /* W = B ^ E mod M. */ void gcry_mpi_powm (gcry_mpi_t w, const gcry_mpi_t b, const gcry_mpi_t e, const gcry_mpi_t m); /* Set G to the greatest common divisor of A and B. Return true if the G is 1. */ int gcry_mpi_gcd (gcry_mpi_t g, gcry_mpi_t a, gcry_mpi_t b); /* Set X to the multiplicative inverse of A mod M. Return true if the value exists. */ int gcry_mpi_invm (gcry_mpi_t x, gcry_mpi_t a, gcry_mpi_t m); /* Return the number of bits required to represent A. */ unsigned int gcry_mpi_get_nbits (gcry_mpi_t a); /* Return true when bit number N (counting from 0) is set in A. */ int gcry_mpi_test_bit (gcry_mpi_t a, unsigned int n); /* Set bit number N in A. */ void gcry_mpi_set_bit (gcry_mpi_t a, unsigned int n); /* Clear bit number N in A. */ void gcry_mpi_clear_bit (gcry_mpi_t a, unsigned int n); /* Set bit number N in A and clear all bits greater than N. */ void gcry_mpi_set_highbit (gcry_mpi_t a, unsigned int n); /* Clear bit number N in A and all bits greater than N. */ void gcry_mpi_clear_highbit (gcry_mpi_t a, unsigned int n); /* Shift the value of A by N bits to the right and store the result in X. */ void gcry_mpi_rshift (gcry_mpi_t x, gcry_mpi_t a, unsigned int n); /* Shift the value of A by N bits to the left and store the result in X. */ void gcry_mpi_lshift (gcry_mpi_t x, gcry_mpi_t a, unsigned int n); /* Store NBITS of the value P points to in A and mark A as an opaque value. WARNING: Never use an opaque MPI for anything thing else then gcry_mpi_release, gcry_mpi_get_opaque. */ gcry_mpi_t gcry_mpi_set_opaque (gcry_mpi_t a, void *p, unsigned int nbits); /* Return a pointer to an opaque value stored in A and return its size in NBITS. Note that the returned pointer is still owned by A and that the function should never be used for an non-opaque MPI. */ void *gcry_mpi_get_opaque (gcry_mpi_t a, unsigned int *nbits); /* Set the FLAG for the big integer A. Currently only the flag GCRYMPI_FLAG_SECURE is allowed to convert A into an big intger stored in "secure" memory. */ void gcry_mpi_set_flag (gcry_mpi_t a, enum gcry_mpi_flag flag); /* Clear FLAG for the big integer A. Note that this function is currently useless as no flags are allowed. */ void gcry_mpi_clear_flag (gcry_mpi_t a, enum gcry_mpi_flag flag); /* Return true when the FLAG is set for A. */ int gcry_mpi_get_flag (gcry_mpi_t a, enum gcry_mpi_flag flag); /* Unless the GCRYPT_NO_MPI_MACROS is used, provide a couple of convenience macros for the big integer functions. */ #ifndef GCRYPT_NO_MPI_MACROS #define mpi_new(n) gcry_mpi_new( (n) ) #define mpi_secure_new( n ) gcry_mpi_snew( (n) ) #define mpi_release(a) \ do \ { \ gcry_mpi_release ((a)); \ (a) = NULL; \ } \ while (0) #define mpi_copy( a ) gcry_mpi_copy( (a) ) #define mpi_set( w, u) gcry_mpi_set( (w), (u) ) #define mpi_set_ui( w, u) gcry_mpi_set_ui( (w), (u) ) #define mpi_cmp( u, v ) gcry_mpi_cmp( (u), (v) ) #define mpi_cmp_ui( u, v ) gcry_mpi_cmp_ui( (u), (v) ) #define mpi_add_ui(w,u,v) gcry_mpi_add_ui((w),(u),(v)) #define mpi_add(w,u,v) gcry_mpi_add ((w),(u),(v)) #define mpi_addm(w,u,v,m) gcry_mpi_addm ((w),(u),(v),(m)) #define mpi_sub_ui(w,u,v) gcry_mpi_sub_ui ((w),(u),(v)) #define mpi_sub(w,u,v) gcry_mpi_sub ((w),(u),(v)) #define mpi_subm(w,u,v,m) gcry_mpi_subm ((w),(u),(v),(m)) #define mpi_mul_ui(w,u,v) gcry_mpi_mul_ui ((w),(u),(v)) #define mpi_mul_2exp(w,u,v) gcry_mpi_mul_2exp ((w),(u),(v)) #define mpi_mul(w,u,v) gcry_mpi_mul ((w),(u),(v)) #define mpi_mulm(w,u,v,m) gcry_mpi_mulm ((w),(u),(v),(m)) #define mpi_powm(w,b,e,m) gcry_mpi_powm ( (w), (b), (e), (m) ) #define mpi_tdiv(q,r,a,m) gcry_mpi_div ( (q), (r), (a), (m), 0) #define mpi_fdiv(q,r,a,m) gcry_mpi_div ( (q), (r), (a), (m), -1) #define mpi_mod(r,a,m) gcry_mpi_mod ((r), (a), (m)) #define mpi_gcd(g,a,b) gcry_mpi_gcd ( (g), (a), (b) ) #define mpi_invm(g,a,b) gcry_mpi_invm ( (g), (a), (b) ) #define mpi_get_nbits(a) gcry_mpi_get_nbits ((a)) #define mpi_test_bit(a,b) gcry_mpi_test_bit ((a),(b)) #define mpi_set_bit(a,b) gcry_mpi_set_bit ((a),(b)) #define mpi_set_highbit(a,b) gcry_mpi_set_highbit ((a),(b)) #define mpi_clear_bit(a,b) gcry_mpi_clear_bit ((a),(b)) #define mpi_clear_highbit(a,b) gcry_mpi_clear_highbit ((a),(b)) #define mpi_rshift(a,b,c) gcry_mpi_rshift ((a),(b),(c)) #define mpi_lshift(a,b,c) gcry_mpi_lshift ((a),(b),(c)) #define mpi_set_opaque(a,b,c) gcry_mpi_set_opaque( (a), (b), (c) ) #define mpi_get_opaque(a,b) gcry_mpi_get_opaque( (a), (b) ) #endif /* GCRYPT_NO_MPI_MACROS */ /************************************ * * * Symmetric Cipher Functions * * * ************************************/ /* The data object used to hold a handle to an encryption object. */ struct gcry_cipher_handle; typedef struct gcry_cipher_handle *gcry_cipher_hd_t; #ifndef GCRYPT_NO_DEPRECATED typedef struct gcry_cipher_handle *GCRY_CIPHER_HD _GCRY_GCC_ATTR_DEPRECATED; typedef struct gcry_cipher_handle *GcryCipherHd _GCRY_GCC_ATTR_DEPRECATED; #endif /* All symmetric encryption algorithms are identified by their IDs. More IDs may be registered at runtime. */ enum gcry_cipher_algos { GCRY_CIPHER_NONE = 0, GCRY_CIPHER_IDEA = 1, GCRY_CIPHER_3DES = 2, GCRY_CIPHER_CAST5 = 3, GCRY_CIPHER_BLOWFISH = 4, GCRY_CIPHER_SAFER_SK128 = 5, GCRY_CIPHER_DES_SK = 6, GCRY_CIPHER_AES = 7, GCRY_CIPHER_AES192 = 8, GCRY_CIPHER_AES256 = 9, GCRY_CIPHER_TWOFISH = 10, /* Other cipher numbers are above 300 for OpenPGP reasons. */ GCRY_CIPHER_ARCFOUR = 301, /* Fully compatible with RSA's RC4 (tm). */ GCRY_CIPHER_DES = 302, /* Yes, this is single key 56 bit DES. */ GCRY_CIPHER_TWOFISH128 = 303, GCRY_CIPHER_SERPENT128 = 304, GCRY_CIPHER_SERPENT192 = 305, GCRY_CIPHER_SERPENT256 = 306, GCRY_CIPHER_RFC2268_40 = 307, /* Ron's Cipher 2 (40 bit). */ GCRY_CIPHER_RFC2268_128 = 308, /* Ron's Cipher 2 (128 bit). */ GCRY_CIPHER_SEED = 309, /* 128 bit cipher described in RFC4269. */ GCRY_CIPHER_CAMELLIA128 = 310, GCRY_CIPHER_CAMELLIA192 = 311, GCRY_CIPHER_CAMELLIA256 = 312 }; /* The Rijndael algorithm is basically AES, so provide some macros. */ #define GCRY_CIPHER_AES128 GCRY_CIPHER_AES #define GCRY_CIPHER_RIJNDAEL GCRY_CIPHER_AES #define GCRY_CIPHER_RIJNDAEL128 GCRY_CIPHER_AES128 #define GCRY_CIPHER_RIJNDAEL192 GCRY_CIPHER_AES192 #define GCRY_CIPHER_RIJNDAEL256 GCRY_CIPHER_AES256 /* The supported encryption modes. Note that not all of them are supported for each algorithm. */ enum gcry_cipher_modes { GCRY_CIPHER_MODE_NONE = 0, /* Not yet specified. */ GCRY_CIPHER_MODE_ECB = 1, /* Electronic codebook. */ GCRY_CIPHER_MODE_CFB = 2, /* Cipher feedback. */ GCRY_CIPHER_MODE_CBC = 3, /* Cipher block chaining. */ GCRY_CIPHER_MODE_STREAM = 4, /* Used with stream ciphers. */ GCRY_CIPHER_MODE_OFB = 5, /* Outer feedback. */ GCRY_CIPHER_MODE_CTR = 6 /* Counter. */ }; /* Flags used with the open function. */ enum gcry_cipher_flags { GCRY_CIPHER_SECURE = 1, /* Allocate in secure memory. */ GCRY_CIPHER_ENABLE_SYNC = 2, /* Enable CFB sync mode. */ GCRY_CIPHER_CBC_CTS = 4, /* Enable CBC cipher text stealing (CTS). */ GCRY_CIPHER_CBC_MAC = 8 /* Enable CBC message auth. code (MAC). */ }; /* Create a handle for algorithm ALGO to be used in MODE. FLAGS may be given as an bitwise OR of the gcry_cipher_flags values. */ gcry_error_t gcry_cipher_open (gcry_cipher_hd_t *handle, int algo, int mode, unsigned int flags); /* Close the cioher handle H and release all resource. */ void gcry_cipher_close (gcry_cipher_hd_t h); /* Perform various operations on the cipher object H. */ gcry_error_t gcry_cipher_ctl (gcry_cipher_hd_t h, int cmd, void *buffer, size_t buflen); /* Retrieve various information about the cipher object H. */ gcry_error_t gcry_cipher_info (gcry_cipher_hd_t h, int what, void *buffer, size_t *nbytes); /* Retrieve various information about the cipher algorithm ALGO. */ gcry_error_t gcry_cipher_algo_info (int algo, int what, void *buffer, size_t *nbytes); /* Map the cipher algorithm whose ID is contained in ALGORITHM to a string representation of the algorithm name. For unknown algorithm IDs this function returns "?". */ const char *gcry_cipher_algo_name (int algorithm) _GCRY_GCC_ATTR_PURE; /* Map the algorithm name NAME to an cipher algorithm ID. Return 0 if the algorithm name is not known. */ int gcry_cipher_map_name (const char *name) _GCRY_GCC_ATTR_PURE; /* Given an ASN.1 object identifier in standard IETF dotted decimal format in STRING, return the encryption mode associated with that OID or 0 if not known or applicable. */ int gcry_cipher_mode_from_oid (const char *string) _GCRY_GCC_ATTR_PURE; /* Encrypt the plaintext of size INLEN in IN using the cipher handle H into the buffer OUT which has an allocated length of OUTSIZE. For most algorithms it is possible to pass NULL for in and 0 for INLEN and do a in-place decryption of the data provided in OUT. */ gcry_error_t gcry_cipher_encrypt (gcry_cipher_hd_t h, void *out, size_t outsize, const void *in, size_t inlen); /* The counterpart to gcry_cipher_encrypt. */ gcry_error_t gcry_cipher_decrypt (gcry_cipher_hd_t h, void *out, size_t outsize, const void *in, size_t inlen); /* Set KEY of length KEYLEN for the cipher handle HD. */ gcry_error_t gcry_cipher_setkey (gcry_cipher_hd_t hd, const void *key, size_t keylen); /* Set initialization vector IV of length IVLEN for the cipher handle HD. */ gcry_error_t gcry_cipher_setiv (gcry_cipher_hd_t hd, const void *iv, size_t ivlen); /* Reset the handle to the state after open. */ #define gcry_cipher_reset(h) gcry_cipher_ctl ((h), GCRYCTL_RESET, NULL, 0) /* Perform the OpenPGP sync operation if this is enabled for the cipher handle H. */ #define gcry_cipher_sync(h) gcry_cipher_ctl( (h), GCRYCTL_CFB_SYNC, NULL, 0) /* Enable or disable CTS in future calls to gcry_encrypt(). CBC mode only. */ #define gcry_cipher_cts(h,on) gcry_cipher_ctl( (h), GCRYCTL_SET_CBC_CTS, \ NULL, on ) /* Set counter for CTR mode. (CTR,CTRLEN) must denote a buffer of block size length, or (NULL,0) to set the CTR to the all-zero block. */ gpg_error_t gcry_cipher_setctr (gcry_cipher_hd_t hd, const void *ctr, size_t ctrlen); /* Retrieved the key length used with algorithm A. */ size_t gcry_cipher_get_algo_keylen (int algo); /* Retrieve the block length used with algorithm A. */ size_t gcry_cipher_get_algo_blklen (int algo); /* Return 0 if the algorithm A is available for use. */ #define gcry_cipher_test_algo(a) \ gcry_cipher_algo_info( (a), GCRYCTL_TEST_ALGO, NULL, NULL ) /* Get a list consisting of the IDs of the loaded cipher modules. If LIST is zero, write the number of loaded cipher modules to LIST_LENGTH and return. If LIST is non-zero, the first *LIST_LENGTH algorithm IDs are stored in LIST, which must be of according size. In case there are less cipher modules than *LIST_LENGTH, *LIST_LENGTH is updated to the correct number. */ gcry_error_t gcry_cipher_list (int *list, int *list_length); /************************************ * * * Asymmetric Cipher Functions * * * ************************************/ /* The algorithms and their IDs we support. */ enum gcry_pk_algos { GCRY_PK_RSA = 1, GCRY_PK_RSA_E = 2, /* (deprecated) */ GCRY_PK_RSA_S = 3, /* (deprecated) */ GCRY_PK_ELG_E = 16, GCRY_PK_DSA = 17, GCRY_PK_ELG = 20, GCRY_PK_ECDSA = 301 }; /* Flags describing usage capabilities of a PK algorithm. */ #define GCRY_PK_USAGE_SIGN 1 /* Good for signatures. */ #define GCRY_PK_USAGE_ENCR 2 /* Good for encryption. */ #define GCRY_PK_USAGE_CERT 4 /* Good to certify other keys. */ #define GCRY_PK_USAGE_AUTH 8 /* Good for authentication. */ #define GCRY_PK_USAGE_UNKN 128 /* Unknown usage flag. */ /* Encrypt the DATA using the public key PKEY and store the result as a newly created S-expression at RESULT. */ gcry_error_t gcry_pk_encrypt (gcry_sexp_t *result, gcry_sexp_t data, gcry_sexp_t pkey); /* Decrypt the DATA using the private key SKEY and store the result as a newly created S-expression at RESULT. */ gcry_error_t gcry_pk_decrypt (gcry_sexp_t *result, gcry_sexp_t data, gcry_sexp_t skey); /* Sign the DATA using the private key SKEY and store the result as a newly created S-expression at RESULT. */ gcry_error_t gcry_pk_sign (gcry_sexp_t *result, gcry_sexp_t data, gcry_sexp_t skey); /* Check the signature SIGVAL on DATA using the public key PKEY. */ gcry_error_t gcry_pk_verify (gcry_sexp_t sigval, gcry_sexp_t data, gcry_sexp_t pkey); /* Check that private KEY is sane. */ gcry_error_t gcry_pk_testkey (gcry_sexp_t key); /* Generate a new key pair according to the parameters given in S_PARMS. The new key pair is returned in as an S-expression in R_KEY. */ gcry_error_t gcry_pk_genkey (gcry_sexp_t *r_key, gcry_sexp_t s_parms); /* Catch all function for miscellaneous operations. */ gcry_error_t gcry_pk_ctl (int cmd, void *buffer, size_t buflen); /* Retrieve information about the public key algorithm ALGO. */ gcry_error_t gcry_pk_algo_info (int algo, int what, void *buffer, size_t *nbytes); /* Map the public key algorithm whose ID is contained in ALGORITHM to a string representation of the algorithm name. For unknown algorithm IDs this functions returns "?". */ const char *gcry_pk_algo_name (int algorithm) _GCRY_GCC_ATTR_PURE; /* Map the algorithm NAME to a public key algorithm Id. Return 0 if the algorithm name is not known. */ int gcry_pk_map_name (const char* name) _GCRY_GCC_ATTR_PURE; /* Return what is commonly referred as the key length for the given public or private KEY. */ unsigned int gcry_pk_get_nbits (gcry_sexp_t key) _GCRY_GCC_ATTR_PURE; /* Please note that keygrip is still experimental and should not be used without contacting the author. */ unsigned char *gcry_pk_get_keygrip (gcry_sexp_t key, unsigned char *array); /* Return 0 if the public key algorithm A is available for use. */ #define gcry_pk_test_algo(a) \ gcry_pk_algo_info( (a), GCRYCTL_TEST_ALGO, NULL, NULL ) /* Get a list consisting of the IDs of the loaded pubkey modules. If LIST is zero, write the number of loaded pubkey modules to LIST_LENGTH and return. If LIST is non-zero, the first *LIST_LENGTH algorithm IDs are stored in LIST, which must be of according size. In case there are less pubkey modules than *LIST_LENGTH, *LIST_LENGTH is updated to the correct number. */ gcry_error_t gcry_pk_list (int *list, int *list_length); /************************************ * * * Cryptograhic Hash Functions * * * ************************************/ /* Algorithm IDs for the hash functions we know about. Not all of them are implemnted. */ enum gcry_md_algos { GCRY_MD_NONE = 0, GCRY_MD_MD5 = 1, GCRY_MD_SHA1 = 2, GCRY_MD_RMD160 = 3, GCRY_MD_MD2 = 5, GCRY_MD_TIGER = 6, /* TIGER/192. */ GCRY_MD_HAVAL = 7, /* HAVAL, 5 pass, 160 bit. */ GCRY_MD_SHA256 = 8, GCRY_MD_SHA384 = 9, GCRY_MD_SHA512 = 10, GCRY_MD_SHA224 = 11, GCRY_MD_MD4 = 301, GCRY_MD_CRC32 = 302, GCRY_MD_CRC32_RFC1510 = 303, GCRY_MD_CRC24_RFC2440 = 304, GCRY_MD_WHIRLPOOL = 305 }; /* Flags used with the open function. */ enum gcry_md_flags { GCRY_MD_FLAG_SECURE = 1, /* Allocate all buffers in "secure" memory. */ GCRY_MD_FLAG_HMAC = 2 /* Make an HMAC out of this algorithm. */ }; /* (Forward declaration.) */ struct gcry_md_context; /* This object is used to hold a handle to a message digest object. This structure is private - only to be used by the public gcry_md_* macros. */ typedef struct gcry_md_handle { /* Actual context. */ struct gcry_md_context *ctx; /* Buffer management. */ int bufpos; int bufsize; unsigned char buf[1]; } *gcry_md_hd_t; /* Compatibility types, do not use them. */ #ifndef GCRYPT_NO_DEPRECATED typedef struct gcry_md_handle *GCRY_MD_HD _GCRY_GCC_ATTR_DEPRECATED; typedef struct gcry_md_handle *GcryMDHd _GCRY_GCC_ATTR_DEPRECATED; #endif /* Create a message digest object for algorithm ALGO. FLAGS may be given as an bitwise OR of the gcry_md_flags values. ALGO may be given as 0 if the algorithms to be used are later set using gcry_md_enable. */ gcry_error_t gcry_md_open (gcry_md_hd_t *h, int algo, unsigned int flags); /* Release the message digest object HD. */ void gcry_md_close (gcry_md_hd_t hd); /* Add the message digest algorithm ALGO to the digest object HD. */ gcry_error_t gcry_md_enable (gcry_md_hd_t hd, int algo); /* Create a new digest object as an exact copy of the object HD. */ gcry_error_t gcry_md_copy (gcry_md_hd_t *bhd, gcry_md_hd_t ahd); /* Reset the digest object HD to its initial state. */ void gcry_md_reset (gcry_md_hd_t hd); /* Perform various operations on the digest object HD. */ gcry_error_t gcry_md_ctl (gcry_md_hd_t hd, int cmd, void *buffer, size_t buflen); /* Pass LENGTH bytes of data in BUFFER to the digest object HD so that it can update the digest values. This is the actual hash function. */ void gcry_md_write (gcry_md_hd_t hd, const void *buffer, size_t length); /* Read out the final digest from HD return the digest value for algorithm ALGO. */ unsigned char *gcry_md_read (gcry_md_hd_t hd, int algo); /* Convenience function to calculate the hash from the data in BUFFER of size LENGTH using the algorithm ALGO avoiding the creating of a hash object. The hash is returned in the caller provided buffer DIGEST which must be large enough to hold the digest of the given algorithm. */ void gcry_md_hash_buffer (int algo, void *digest, const void *buffer, size_t length); /* Retrieve the algorithm used with HD. This does not work reliable if more than one algorithm is enabled in HD. */ int gcry_md_get_algo (gcry_md_hd_t hd); /* Retrieve the length in bytes of the digest yielded by algorithm ALGO. */ unsigned int gcry_md_get_algo_dlen (int algo); /* Return true if the the algorithm ALGO is enabled in the digest object A. */ int gcry_md_is_enabled (gcry_md_hd_t a, int algo); /* Return true if the digest object A is allocated in "secure" memory. */ int gcry_md_is_secure (gcry_md_hd_t a); /* Retrieve various information about the object H. */ gcry_error_t gcry_md_info (gcry_md_hd_t h, int what, void *buffer, size_t *nbytes); /* Retrieve various information about the algorithm ALGO. */ gcry_error_t gcry_md_algo_info (int algo, int what, void *buffer, size_t *nbytes); /* Map the digest algorithm id ALGO to a string representation of the algorithm name. For unknown algorithms this function returns "?". */ const char *gcry_md_algo_name (int algo) _GCRY_GCC_ATTR_PURE; /* Map the algorithm NAME to a digest algorithm Id. Return 0 if the algorithm name is not known. */ int gcry_md_map_name (const char* name) _GCRY_GCC_ATTR_PURE; /* For use with the HMAC feature, the set MAC key to the KEY of KEYLEN. */ gcry_error_t gcry_md_setkey (gcry_md_hd_t hd, const void *key, size_t keylen); /* Start or stop debugging for digest handle HD; i.e. create a file named dbgmd-. while hashing. If SUFFIX is NULL, debugging stops and the file will be closed. */ void gcry_md_debug (gcry_md_hd_t hd, const char *suffix); /* Update the hash(s) of H with the character C. This is a buffered version of the gcry_md_write function. */ #define gcry_md_putc(h,c) \ do { \ gcry_md_hd_t h__ = (h); \ if( (h__)->bufpos == (h__)->bufsize ) \ gcry_md_write( (h__), NULL, 0 ); \ (h__)->buf[(h__)->bufpos++] = (c) & 0xff; \ } while(0) /* Finalize the digest calculation. This is not really needed because gcry_md_read() does this implicitly. */ #define gcry_md_final(a) \ gcry_md_ctl ((a), GCRYCTL_FINALIZE, NULL, 0) /* Return 0 if the algorithm A is available for use. */ #define gcry_md_test_algo(a) \ gcry_md_algo_info( (a), GCRYCTL_TEST_ALGO, NULL, NULL ) /* Return an DER encoded ASN.1 OID for the algorithm A in buffer B. N must point to size_t variable with the available size of buffer B. After return it will receive the actual size of the returned OID. */ #define gcry_md_get_asnoid(a,b,n) \ gcry_md_algo_info((a), GCRYCTL_GET_ASNOID, (b), (n)) /* Enable debugging for digest object A; i.e. create files named dbgmd-. while hashing. B is a string used as the suffix for the filename. This macro is deprecated, use gcry_md_debug. */ #ifndef GCRYPT_NO_DEPRECATED #define gcry_md_start_debug(a,b) \ gcry_md_ctl( (a), GCRYCTL_START_DUMP, (b), 0 ) /* Disable the debugging of A. This macro is deprecated, use gcry_md_debug. */ #define gcry_md_stop_debug(a,b) \ gcry_md_ctl( (a), GCRYCTL_STOP_DUMP, (b), 0 ) #endif /* Get a list consisting of the IDs of the loaded message digest modules. If LIST is zero, write the number of loaded message digest modules to LIST_LENGTH and return. If LIST is non-zero, the first *LIST_LENGTH algorithm IDs are stored in LIST, which must be of according size. In case there are less message digest modules than *LIST_LENGTH, *LIST_LENGTH is updated to the correct number. */ gcry_error_t gcry_md_list (int *list, int *list_length); /* Alternative interface for asymmetric cryptography. This interface is deprecated. */ /* The algorithm IDs. */ typedef enum gcry_ac_id { GCRY_AC_RSA = 1, GCRY_AC_DSA = 17, GCRY_AC_ELG = 20, GCRY_AC_ELG_E = 16 } gcry_ac_id_t; /* Key types. */ typedef enum gcry_ac_key_type { GCRY_AC_KEY_SECRET, GCRY_AC_KEY_PUBLIC } gcry_ac_key_type_t; /* Encoding methods. */ typedef enum gcry_ac_em { GCRY_AC_EME_PKCS_V1_5, GCRY_AC_EMSA_PKCS_V1_5 } gcry_ac_em_t; /* Encryption and Signature schemes. */ typedef enum gcry_ac_scheme { GCRY_AC_ES_PKCS_V1_5, GCRY_AC_SSA_PKCS_V1_5 } gcry_ac_scheme_t; /* AC data. */ #define GCRY_AC_FLAG_DEALLOC (1 << 0) #define GCRY_AC_FLAG_COPY (1 << 1) #define GCRY_AC_FLAG_NO_BLINDING (1 << 2) /* This type represents a `data set'. */ typedef struct gcry_ac_data *gcry_ac_data_t; /* This type represents a single `key', either a secret one or a public one. */ typedef struct gcry_ac_key *gcry_ac_key_t; /* This type represents a `key pair' containing a secret and a public key. */ typedef struct gcry_ac_key_pair *gcry_ac_key_pair_t; /* This type represents a `handle' that is needed by functions performing cryptographic operations. */ typedef struct gcry_ac_handle *gcry_ac_handle_t; typedef gpg_error_t (*gcry_ac_data_read_cb_t) (void *opaque, unsigned char *buffer, size_t *buffer_n); typedef gpg_error_t (*gcry_ac_data_write_cb_t) (void *opaque, unsigned char *buffer, size_t buffer_n); typedef enum { GCRY_AC_IO_READABLE, GCRY_AC_IO_WRITABLE } gcry_ac_io_mode_t; typedef enum { GCRY_AC_IO_STRING, GCRY_AC_IO_CALLBACK } gcry_ac_io_type_t; typedef struct gcry_ac_io { /* This is an INTERNAL structure, do NOT use manually. */ gcry_ac_io_mode_t mode _GCRY_ATTR_INTERNAL; gcry_ac_io_type_t type _GCRY_ATTR_INTERNAL; union { union { struct { gcry_ac_data_read_cb_t cb; void *opaque; } callback; struct { unsigned char *data; size_t data_n; } string; void *opaque; } readable; union { struct { gcry_ac_data_write_cb_t cb; void *opaque; } callback; struct { unsigned char **data; size_t *data_n; } string; void *opaque; } writable; } io _GCRY_ATTR_INTERNAL; } gcry_ac_io_t; /* The caller of gcry_ac_key_pair_generate can provide one of these structures in order to influence the key generation process in an algorithm-specific way. */ typedef struct gcry_ac_key_spec_rsa { gcry_mpi_t e; /* E to use. */ } gcry_ac_key_spec_rsa_t; /* Structure used for passing data to the implementation of the `EME-PKCS-V1_5' encoding method. */ typedef struct gcry_ac_eme_pkcs_v1_5 { size_t key_size; } gcry_ac_eme_pkcs_v1_5_t; typedef enum gcry_md_algos gcry_md_algo_t; /* Structure used for passing data to the implementation of the `EMSA-PKCS-V1_5' encoding method. */ typedef struct gcry_ac_emsa_pkcs_v1_5 { gcry_md_algo_t md; size_t em_n; } gcry_ac_emsa_pkcs_v1_5_t; /* Structure used for passing data to the implementation of the `SSA-PKCS-V1_5' signature scheme. */ typedef struct gcry_ac_ssa_pkcs_v1_5 { gcry_md_algo_t md; } gcry_ac_ssa_pkcs_v1_5_t; /* Returns a new, empty data set in DATA. */ gcry_error_t gcry_ac_data_new (gcry_ac_data_t *data); /* Destroy the data set DATA. */ void gcry_ac_data_destroy (gcry_ac_data_t data); /* Create a copy of the data set DATA and store it in DATA_CP. */ gcry_error_t gcry_ac_data_copy (gcry_ac_data_t *data_cp, gcry_ac_data_t data); /* Return the number of named MPI values inside of the data set DATA. */ unsigned int gcry_ac_data_length (gcry_ac_data_t data); /* Destroy any values contained in the data set DATA. */ void gcry_ac_data_clear (gcry_ac_data_t data); /* Add the value MPI to DATA with the label NAME. If FLAGS contains GCRY_AC_FLAG_DATA_COPY, the data set will contain copies of NAME and MPI. If FLAGS contains GCRY_AC_FLAG_DATA_DEALLOC or GCRY_AC_FLAG_DATA_COPY, the values contained in the data set will be deallocated when they are to be removed from the data set. */ gcry_error_t gcry_ac_data_set (gcry_ac_data_t data, unsigned int flags, const char *name, gcry_mpi_t mpi); /* Store the value labelled with NAME found in DATA in MPI. If FLAGS contains GCRY_AC_FLAG_COPY, store a copy of the MPI value contained in the data set. MPI may be NULL. */ gcry_error_t gcry_ac_data_get_name (gcry_ac_data_t data, unsigned int flags, const char *name, gcry_mpi_t *mpi); /* Stores in NAME and MPI the named MPI value contained in the data set DATA with the index IDX. If FLAGS contains GCRY_AC_FLAG_COPY, store copies of the values contained in the data set. NAME or MPI may be NULL. */ gcry_error_t gcry_ac_data_get_index (gcry_ac_data_t data, unsigned int flags, unsigned int idx, const char **name, gcry_mpi_t *mpi); /* Convert the data set DATA into a new S-Expression, which is to be stored in SEXP, according to the identifiers contained in IDENTIFIERS. */ gcry_error_t gcry_ac_data_to_sexp (gcry_ac_data_t data, gcry_sexp_t *sexp, const char **identifiers); /* Create a new data set, which is to be stored in DATA_SET, from the S-Expression SEXP, according to the identifiers contained in IDENTIFIERS. */ gcry_error_t gcry_ac_data_from_sexp (gcry_ac_data_t *data, gcry_sexp_t sexp, const char **identifiers); /* Initialize AC_IO according to MODE, TYPE and the variable list of arguments. The list of variable arguments to specify depends on the given TYPE. */ void gcry_ac_io_init (gcry_ac_io_t *ac_io, gcry_ac_io_mode_t mode, gcry_ac_io_type_t type, ...); /* Initialize AC_IO according to MODE, TYPE and the variable list of arguments AP. The list of variable arguments to specify depends on the given TYPE. */ void gcry_ac_io_init_va (gcry_ac_io_t *ac_io, gcry_ac_io_mode_t mode, gcry_ac_io_type_t type, va_list ap); /* Create a new ac handle. */ gcry_error_t gcry_ac_open (gcry_ac_handle_t *handle, gcry_ac_id_t algorithm, unsigned int flags); /* Destroy an ac handle. */ void gcry_ac_close (gcry_ac_handle_t handle); /* Initialize a key from a given data set. */ gcry_error_t gcry_ac_key_init (gcry_ac_key_t *key, gcry_ac_handle_t handle, gcry_ac_key_type_t type, gcry_ac_data_t data); /* Generates a new key pair via the handle HANDLE of NBITS bits and stores it in KEY_PAIR. In case non-standard settings are wanted, a pointer to a structure of type gcry_ac_key_spec__t, matching the selected algorithm, can be given as KEY_SPEC. MISC_DATA is not used yet. */ gcry_error_t gcry_ac_key_pair_generate (gcry_ac_handle_t handle, unsigned int nbits, void *spec, gcry_ac_key_pair_t *key_pair, gcry_mpi_t **misc_data); /* Returns the key of type WHICH out of the key pair KEY_PAIR. */ gcry_ac_key_t gcry_ac_key_pair_extract (gcry_ac_key_pair_t key_pair, gcry_ac_key_type_t which); /* Returns the data set contained in the key KEY. */ gcry_ac_data_t gcry_ac_key_data_get (gcry_ac_key_t key); /* Verifies that the key KEY is sane via HANDLE. */ gcry_error_t gcry_ac_key_test (gcry_ac_handle_t handle, gcry_ac_key_t key); /* Stores the number of bits of the key KEY in NBITS via HANDLE. */ gcry_error_t gcry_ac_key_get_nbits (gcry_ac_handle_t handle, gcry_ac_key_t key, unsigned int *nbits); /* Writes the 20 byte long key grip of the key KEY to KEY_GRIP via HANDLE. */ gcry_error_t gcry_ac_key_get_grip (gcry_ac_handle_t handle, gcry_ac_key_t key, unsigned char *key_grip); /* Destroy a key. */ void gcry_ac_key_destroy (gcry_ac_key_t key); /* Destroy a key pair. */ void gcry_ac_key_pair_destroy (gcry_ac_key_pair_t key_pair); /* Encodes a message according to the encoding method METHOD. OPTIONS must be a pointer to a method-specific structure (gcry_ac_em*_t). */ gcry_error_t gcry_ac_data_encode (gcry_ac_em_t method, unsigned int flags, void *options, gcry_ac_io_t *io_read, gcry_ac_io_t *io_write); /* Decodes a message according to the encoding method METHOD. OPTIONS must be a pointer to a method-specific structure (gcry_ac_em*_t). */ gcry_error_t gcry_ac_data_decode (gcry_ac_em_t method, unsigned int flags, void *options, gcry_ac_io_t *io_read, gcry_ac_io_t *io_write); /* Encrypt the plain text MPI value DATA_PLAIN with the key KEY under the control of the flags FLAGS and store the resulting data set into DATA_ENCRYPTED. */ gcry_error_t gcry_ac_data_encrypt (gcry_ac_handle_t handle, unsigned int flags, gcry_ac_key_t key, gcry_mpi_t data_plain, gcry_ac_data_t *data_encrypted); /* Decrypt the decrypted data contained in the data set DATA_ENCRYPTED with the key KEY under the control of the flags FLAGS and store the resulting plain text MPI value in DATA_PLAIN. */ gcry_error_t gcry_ac_data_decrypt (gcry_ac_handle_t handle, unsigned int flags, gcry_ac_key_t key, gcry_mpi_t *data_plain, gcry_ac_data_t data_encrypted); /* Sign the data contained in DATA with the key KEY and store the resulting signature in the data set DATA_SIGNATURE. */ gcry_error_t gcry_ac_data_sign (gcry_ac_handle_t handle, gcry_ac_key_t key, gcry_mpi_t data, gcry_ac_data_t *data_signature); /* Verify that the signature contained in the data set DATA_SIGNATURE is indeed the result of signing the data contained in DATA with the secret key belonging to the public key KEY. */ gcry_error_t gcry_ac_data_verify (gcry_ac_handle_t handle, gcry_ac_key_t key, gcry_mpi_t data, gcry_ac_data_t data_signature); /* Encrypts the plain text readable from IO_MESSAGE through HANDLE with the public key KEY according to SCHEME, FLAGS and OPTS. If OPTS is not NULL, it has to be a pointer to a structure specific to the chosen scheme (gcry_ac_es_*_t). The encrypted message is written to IO_CIPHER. */ gcry_error_t gcry_ac_data_encrypt_scheme (gcry_ac_handle_t handle, gcry_ac_scheme_t scheme, unsigned int flags, void *opts, gcry_ac_key_t key, gcry_ac_io_t *io_message, gcry_ac_io_t *io_cipher); /* Decrypts the cipher text readable from IO_CIPHER through HANDLE with the secret key KEY according to SCHEME, @var{flags} and OPTS. If OPTS is not NULL, it has to be a pointer to a structure specific to the chosen scheme (gcry_ac_es_*_t). The decrypted message is written to IO_MESSAGE. */ gcry_error_t gcry_ac_data_decrypt_scheme (gcry_ac_handle_t handle, gcry_ac_scheme_t scheme, unsigned int flags, void *opts, gcry_ac_key_t key, gcry_ac_io_t *io_cipher, gcry_ac_io_t *io_message); /* Signs the message readable from IO_MESSAGE through HANDLE with the secret key KEY according to SCHEME, FLAGS and OPTS. If OPTS is not NULL, it has to be a pointer to a structure specific to the chosen scheme (gcry_ac_ssa_*_t). The signature is written to IO_SIGNATURE. */ gcry_error_t gcry_ac_data_sign_scheme (gcry_ac_handle_t handle, gcry_ac_scheme_t scheme, unsigned int flags, void *opts, gcry_ac_key_t key, gcry_ac_io_t *io_message, gcry_ac_io_t *io_signature); /* Verifies through HANDLE that the signature readable from IO_SIGNATURE is indeed the result of signing the message readable from IO_MESSAGE with the secret key belonging to the public key KEY according to SCHEME and OPTS. If OPTS is not NULL, it has to be an anonymous structure (gcry_ac_ssa_*_t) specific to the chosen scheme. */ gcry_error_t gcry_ac_data_verify_scheme (gcry_ac_handle_t handle, gcry_ac_scheme_t scheme, unsigned int flags, void *opts, gcry_ac_key_t key, gcry_ac_io_t *io_message, gcry_ac_io_t *io_signature); /* Store the textual representation of the algorithm whose id is given in ALGORITHM in NAME. This function is deprecated; use gcry_pk_algo_name. */ #ifndef GCRYPT_NO_DEPRECATED gcry_error_t gcry_ac_id_to_name (gcry_ac_id_t algorithm, const char **name) /* */ _GCRY_GCC_ATTR_DEPRECATED; /* Store the numeric ID of the algorithm whose textual representation is contained in NAME in ALGORITHM. This function is deprecated; use gcry_pk_map_name. */ gcry_error_t gcry_ac_name_to_id (const char *name, gcry_ac_id_t *algorithm) /* */ _GCRY_GCC_ATTR_DEPRECATED; #endif /************************************ * * * Random Generating Functions * * * ************************************/ /* The possible values for the random quality. The rule of thumb is to use STRONG for session keys and VERY_STRONG for key material. WEAK is usually an alias for STRONG and should not be used anymore (except with gcry_mpi_randomize); use gcry_create_nonce instead. */ typedef enum gcry_random_level { GCRY_WEAK_RANDOM = 0, GCRY_STRONG_RANDOM = 1, GCRY_VERY_STRONG_RANDOM = 2 } gcry_random_level_t; /* Fill BUFFER with LENGTH bytes of random, using random numbers of quality LEVEL. */ void gcry_randomize (void *buffer, size_t length, enum gcry_random_level level); /* Add the external random from BUFFER with LENGTH bytes into the pool. QUALITY should either be -1 for unknown or in the range of 0 to 100 */ gcry_error_t gcry_random_add_bytes (const void *buffer, size_t length, int quality); /* If random numbers are used in an application, this macro should be called from time to time so that new stuff gets added to the internal pool of the RNG. */ #define gcry_fast_random_poll() gcry_control (GCRYCTL_FAST_POLL, NULL) /* Return NBYTES of allocated random using a random numbers of quality LEVEL. */ void *gcry_random_bytes (size_t nbytes, enum gcry_random_level level) _GCRY_GCC_ATTR_MALLOC; /* Return NBYTES of allocated random using a random numbers of quality LEVEL. The random numbers are created returned in "secure" memory. */ void *gcry_random_bytes_secure (size_t nbytes, enum gcry_random_level level) _GCRY_GCC_ATTR_MALLOC; /* Set the big integer W to a random value of NBITS using a random generator with quality LEVEL. Note that by using a level of GCRY_WEAK_RANDOM gcry_create_nonce is used internally. */ void gcry_mpi_randomize (gcry_mpi_t w, unsigned int nbits, enum gcry_random_level level); /* Create an unpredicable nonce of LENGTH bytes in BUFFER. */ void gcry_create_nonce (void *buffer, size_t length); /*******************************/ /* */ /* Prime Number Functions */ /* */ /*******************************/ /* Mode values passed to a gcry_prime_check_func_t. */ #define GCRY_PRIME_CHECK_AT_FINISH 0 #define GCRY_PRIME_CHECK_AT_GOT_PRIME 1 #define GCRY_PRIME_CHECK_AT_MAYBE_PRIME 2 /* The function should return 1 if the operation shall continue, 0 to reject the prime candidate. */ typedef int (*gcry_prime_check_func_t) (void *arg, int mode, gcry_mpi_t candidate); /* Flags for gcry_prime_generate(): */ /* Allocate prime numbers and factors in secure memory. */ #define GCRY_PRIME_FLAG_SECRET (1 << 0) /* Make sure that at least one prime factor is of size `FACTOR_BITS'. */ #define GCRY_PRIME_FLAG_SPECIAL_FACTOR (1 << 1) /* Generate a new prime number of PRIME_BITS bits and store it in PRIME. If FACTOR_BITS is non-zero, one of the prime factors of (prime - 1) / 2 must be FACTOR_BITS bits long. If FACTORS is non-zero, allocate a new, NULL-terminated array holding the prime factors and store it in FACTORS. FLAGS might be used to influence the prime number generation process. */ gcry_error_t gcry_prime_generate (gcry_mpi_t *prime, unsigned int prime_bits, unsigned int factor_bits, gcry_mpi_t **factors, gcry_prime_check_func_t cb_func, void *cb_arg, gcry_random_level_t random_level, unsigned int flags); /* Find a generator for PRIME where the factorization of (prime-1) is in the NULL terminated array FACTORS. Return the generator as a newly allocated MPI in R_G. If START_G is not NULL, use this as teh start for the search. */ gcry_error_t gcry_prime_group_generator (gcry_mpi_t *r_g, gcry_mpi_t prime, gcry_mpi_t *factors, gcry_mpi_t start_g); /* Convenience function to release the FACTORS array. */ void gcry_prime_release_factors (gcry_mpi_t *factors); /* Check wether the number X is prime. */ gcry_error_t gcry_prime_check (gcry_mpi_t x, unsigned int flags); /************************************ * * * Miscellaneous Stuff * * * ************************************/ /* Log levels used by the internal logging facility. */ enum gcry_log_levels { GCRY_LOG_CONT = 0, /* (Continue the last log line.) */ GCRY_LOG_INFO = 10, GCRY_LOG_WARN = 20, GCRY_LOG_ERROR = 30, GCRY_LOG_FATAL = 40, GCRY_LOG_BUG = 50, GCRY_LOG_DEBUG = 100 }; /* Type for progress handlers. */ typedef void (*gcry_handler_progress_t) (void *, const char *, int, int, int); /* Type for memory allocation handlers. */ typedef void *(*gcry_handler_alloc_t) (size_t n); /* Type for secure memory check handlers. */ typedef int (*gcry_handler_secure_check_t) (const void *); /* Type for memory reallocation handlers. */ typedef void *(*gcry_handler_realloc_t) (void *p, size_t n); /* Type for memory free handlers. */ typedef void (*gcry_handler_free_t) (void *); /* Type for out-of-memory handlers. */ typedef int (*gcry_handler_no_mem_t) (void *, size_t, unsigned int); /* Type for fatal error handlers. */ typedef void (*gcry_handler_error_t) (void *, int, const char *); /* Type for logging handlers. */ typedef void (*gcry_handler_log_t) (void *, int, const char *, va_list); /* Certain operations can provide progress information. This function is used to register a handler for retrieving these information. */ void gcry_set_progress_handler (gcry_handler_progress_t cb, void *cb_data); /* Register a custom memory allocation functions. */ void gcry_set_allocation_handler ( gcry_handler_alloc_t func_alloc, gcry_handler_alloc_t func_alloc_secure, gcry_handler_secure_check_t func_secure_check, gcry_handler_realloc_t func_realloc, gcry_handler_free_t func_free); /* Register a function used instead of the internal out of memory handler. */ void gcry_set_outofcore_handler (gcry_handler_no_mem_t h, void *opaque); /* Register a function used instead of the internal fatal error handler. */ void gcry_set_fatalerror_handler (gcry_handler_error_t fnc, void *opaque); /* Register a function used instead of the internal logging facility. */ void gcry_set_log_handler (gcry_handler_log_t f, void *opaque); /* Reserved for future use. */ void gcry_set_gettext_handler (const char *(*f)(const char*)); /* Libgcrypt uses its own memory allocation. It is important to use gcry_free () to release memory allocated by libgcrypt. */ void *gcry_malloc (size_t n) _GCRY_GCC_ATTR_MALLOC; void *gcry_calloc (size_t n, size_t m) _GCRY_GCC_ATTR_MALLOC; void *gcry_malloc_secure (size_t n) _GCRY_GCC_ATTR_MALLOC; void *gcry_calloc_secure (size_t n, size_t m) _GCRY_GCC_ATTR_MALLOC; void *gcry_realloc (void *a, size_t n); char *gcry_strdup (const char *string) _GCRY_GCC_ATTR_MALLOC; void *gcry_xmalloc (size_t n) _GCRY_GCC_ATTR_MALLOC; void *gcry_xcalloc (size_t n, size_t m) _GCRY_GCC_ATTR_MALLOC; void *gcry_xmalloc_secure (size_t n) _GCRY_GCC_ATTR_MALLOC; void *gcry_xcalloc_secure (size_t n, size_t m) _GCRY_GCC_ATTR_MALLOC; void *gcry_xrealloc (void *a, size_t n); char *gcry_xstrdup (const char * a) _GCRY_GCC_ATTR_MALLOC; void gcry_free (void *a); /* Return true if A is allocated in "secure" memory. */ int gcry_is_secure (const void *a) _GCRY_GCC_ATTR_PURE; /* Return true if Libgcrypt is in FIPS mode. */ #define gcry_fips_mode_active() !!gcry_control (GCRYCTL_FIPS_MODE_P, 0) /* Include support for Libgcrypt modules. */ #include #if 0 /* (Keep Emacsens' auto-indent happy.) */ { #endif #ifdef __cplusplus } #endif #endif /* _GCRYPT_H */ ./libgcrypt-1.4.4-i686/usr/local/include/gcrypt-module.h0000644000000000000000000001602011237045207021336 0ustar rootroot/* gcrypt-module.h - GNU Cryptographic Library Interface Copyright (C) 2003, 2007 Free Software Foundation, Inc. This file is part of Libgcrypt. Libgcrypt is free software; you can redistribute it and/or modify it under the terms of the GNU Lesser General Public License as published by the Free Software Foundation; either version 2.1 of the License, or (at your option) any later version. Libgcrypt is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Lesser General Public License for more details. You should have received a copy of the GNU Lesser General Public License along with this program; if not, see . */ /* This file contains the necessary declarations/definitions for working with Libgcrypt modules. */ #ifndef _GCRYPT_MODULE_H #define _GCRYPT_MODULE_H #ifdef __cplusplus extern "C" { #if 0 /* keep Emacsens's auto-indent happy */ } #endif #endif /* The interfaces using the module system reserve a certain range of IDs for application use. These IDs are not valid within Libgcrypt but Libgcrypt makes sure never to allocate such a module ID. */ #define GCRY_MODULE_ID_USER 1024 #define GCRY_MODULE_ID_USER_LAST 4095 /* This type represents a `module'. */ typedef struct gcry_module *gcry_module_t; /* Check that the library fulfills the version requirement. */ /* Type for the cipher_setkey function. */ typedef gcry_err_code_t (*gcry_cipher_setkey_t) (void *c, const unsigned char *key, unsigned keylen); /* Type for the cipher_encrypt function. */ typedef void (*gcry_cipher_encrypt_t) (void *c, unsigned char *outbuf, const unsigned char *inbuf); /* Type for the cipher_decrypt function. */ typedef void (*gcry_cipher_decrypt_t) (void *c, unsigned char *outbuf, const unsigned char *inbuf); /* Type for the cipher_stencrypt function. */ typedef void (*gcry_cipher_stencrypt_t) (void *c, unsigned char *outbuf, const unsigned char *inbuf, unsigned int n); /* Type for the cipher_stdecrypt function. */ typedef void (*gcry_cipher_stdecrypt_t) (void *c, unsigned char *outbuf, const unsigned char *inbuf, unsigned int n); typedef struct gcry_cipher_oid_spec { const char *oid; int mode; } gcry_cipher_oid_spec_t; /* Module specification structure for ciphers. */ typedef struct gcry_cipher_spec { const char *name; const char **aliases; gcry_cipher_oid_spec_t *oids; size_t blocksize; size_t keylen; size_t contextsize; gcry_cipher_setkey_t setkey; gcry_cipher_encrypt_t encrypt; gcry_cipher_decrypt_t decrypt; gcry_cipher_stencrypt_t stencrypt; gcry_cipher_stdecrypt_t stdecrypt; } gcry_cipher_spec_t; /* Register a new cipher module whose specification can be found in CIPHER. On success, a new algorithm ID is stored in ALGORITHM_ID and a pointer representing this module is stored in MODULE. */ gcry_error_t gcry_cipher_register (gcry_cipher_spec_t *cipher, int *algorithm_id, gcry_module_t *module); /* Unregister the cipher identified by MODULE, which must have been registered with gcry_cipher_register. */ void gcry_cipher_unregister (gcry_module_t module); /* ********************** */ /* Type for the pk_generate function. */ typedef gcry_err_code_t (*gcry_pk_generate_t) (int algo, unsigned int nbits, unsigned long use_e, gcry_mpi_t *skey, gcry_mpi_t **retfactors); /* Type for the pk_check_secret_key function. */ typedef gcry_err_code_t (*gcry_pk_check_secret_key_t) (int algo, gcry_mpi_t *skey); /* Type for the pk_encrypt function. */ typedef gcry_err_code_t (*gcry_pk_encrypt_t) (int algo, gcry_mpi_t *resarr, gcry_mpi_t data, gcry_mpi_t *pkey, int flags); /* Type for the pk_decrypt function. */ typedef gcry_err_code_t (*gcry_pk_decrypt_t) (int algo, gcry_mpi_t *result, gcry_mpi_t *data, gcry_mpi_t *skey, int flags); /* Type for the pk_sign function. */ typedef gcry_err_code_t (*gcry_pk_sign_t) (int algo, gcry_mpi_t *resarr, gcry_mpi_t data, gcry_mpi_t *skey); /* Type for the pk_verify function. */ typedef gcry_err_code_t (*gcry_pk_verify_t) (int algo, gcry_mpi_t hash, gcry_mpi_t *data, gcry_mpi_t *pkey, int (*cmp) (void *, gcry_mpi_t), void *opaquev); /* Type for the pk_get_nbits function. */ typedef unsigned (*gcry_pk_get_nbits_t) (int algo, gcry_mpi_t *pkey); /* Module specification structure for message digests. */ typedef struct gcry_pk_spec { const char *name; const char **aliases; const char *elements_pkey; const char *elements_skey; const char *elements_enc; const char *elements_sig; const char *elements_grip; int use; gcry_pk_generate_t generate; gcry_pk_check_secret_key_t check_secret_key; gcry_pk_encrypt_t encrypt; gcry_pk_decrypt_t decrypt; gcry_pk_sign_t sign; gcry_pk_verify_t verify; gcry_pk_get_nbits_t get_nbits; } gcry_pk_spec_t; /* Register a new pubkey module whose specification can be found in PUBKEY. On success, a new algorithm ID is stored in ALGORITHM_ID and a pointer representhing this module is stored in MODULE. */ gcry_error_t gcry_pk_register (gcry_pk_spec_t *pubkey, unsigned int *algorithm_id, gcry_module_t *module); /* Unregister the pubkey identified by ID, which must have been registered with gcry_pk_register. */ void gcry_pk_unregister (gcry_module_t module); /* ********************** */ /* Type for the md_init function. */ typedef void (*gcry_md_init_t) (void *c); /* Type for the md_write function. */ typedef void (*gcry_md_write_t) (void *c, const void *buf, size_t nbytes); /* Type for the md_final function. */ typedef void (*gcry_md_final_t) (void *c); /* Type for the md_read function. */ typedef unsigned char *(*gcry_md_read_t) (void *c); typedef struct gcry_md_oid_spec { const char *oidstring; } gcry_md_oid_spec_t; /* Module specification structure for message digests. */ typedef struct gcry_md_spec { const char *name; unsigned char *asnoid; int asnlen; gcry_md_oid_spec_t *oids; int mdlen; gcry_md_init_t init; gcry_md_write_t write; gcry_md_final_t final; gcry_md_read_t read; size_t contextsize; /* allocate this amount of context */ } gcry_md_spec_t; /* Register a new digest module whose specification can be found in DIGEST. On success, a new algorithm ID is stored in ALGORITHM_ID and a pointer representhing this module is stored in MODULE. */ gcry_error_t gcry_md_register (gcry_md_spec_t *digest, unsigned int *algorithm_id, gcry_module_t *module); /* Unregister the digest identified by ID, which must have been registered with gcry_digest_register. */ void gcry_md_unregister (gcry_module_t module); #if 0 /* keep Emacsens's auto-indent happy */ { #endif #ifdef __cplusplus } #endif #endif ./libgcrypt-1.4.4-i686/usr/local/lib/0000755000000000000000000000000011237045211015511 5ustar rootroot./libgcrypt-1.4.4-i686/usr/local/lib/libgcrypt.so.110000777000000000000000000000000011237045211023355 2libgcrypt.so.11.5.2ustar rootroot./libgcrypt-1.4.4-i686/usr/local/lib/libgcrypt.so0000777000000000000000000000000011237045211023135 2libgcrypt.so.11.5.2ustar rootroot./libgcrypt-1.4.4-i686/usr/local/lib/libgcrypt.so.11.5.20000755000000000000000000242026311237045210020611 0ustar rootrootELF`F4(= 4 (XX\WLZQtd 2g&Q/rc(T19 ^xVPX)7t?FfNJ]vz3Eha}YKq-. nl wo%;su~p' @A =G* :4DW >Udj$mH<`|[\6"ZLMBybieI0R{C85#+,k! _SO %2P8 6I8 _# FK* Q* K Dc? K# W*Y' pl4CQ1 }R1 \1 ^# LXZ k`# \J l* DG# uP1 PRG# oM* fM  j# [# ` e8 lJ2 TQ jP1 [fM W#   G# xYS  Mk? ^B W# Zn]* Kg,N1 <XZ J1 Tp: c8 Z; P? l zl# -IA/G# S* JI8  b1 { ^m a? a# J* J* m# m* _A%f\S TQ  gO L* 3[B bpM* { JjT 8M* V# x8jJ* / n# M? UeL# * -S* 8ia8 . L* ZO8 HU8 hO1 2o# %DUQ l :1FR* fM b8 7m* U \d# i ij ' k* Bb> vH? 8UX {(,4XZ _Q D`# { n# a1 am# H8 x^# hk =7. #k* ZZX c1 c* "t fM L# X_8 YBYQ $iI# pN1 6]R1 L4]:  Q8  hq 3 G# j* Z# 2\# FpR* f>  m* l# yIJ# R! d? PbL# l* AN8 Q*  X* N? k* G* n84 e 2Y%VX pK# c1I8 Sa n9 v Z9 _e? T# + hj eW_ HD Y`* V i1 [I# d? C4L1 S zn# e c* Q# Z# +d1 N e8 V# '`* d# b1 #K# 4V =6O1 C k* R* j n9 l&Q`* BgS % m# Va~ c# :_# [Z ; Z3 m# 8m8$ e? o}V#  hQ WS* JgO1 j8 pL# _X , b# #-P1 H6 yN# /N8 = Eij 1a8 X l# G K# o> An9 S* ,mR1 @\X u[* >H8 "} Pl* tQ1 K1 EM* q -l# hYC iuG# )Z1 3{`# g]s s>__gmon_start____cxa_finalize_Jv_RegisterClassesgcry_strerrorgcry_strsourcegcry_err_code_from_errnogcry_err_code_to_errnogcry_err_make_from_errnogcry_error_from_errnogcry_check_versiongcry_controlgcry_sexp_newgcry_sexp_creategcry_sexp_sscangcry_sexp_buildgcry_sexp_build_arraygcry_sexp_releasegcry_sexp_canon_lengcry_sexp_sprintgcry_sexp_dumpgcry_sexp_consgcry_sexp_alistgcry_sexp_vlistgcry_sexp_appendgcry_sexp_prependgcry_sexp_find_tokengcry_sexp_lengthgcry_sexp_nthgcry_sexp_cargcry_sexp_cdrgcry_sexp_cadrgcry_sexp_nth_datagcry_sexp_nth_stringgcry_sexp_nth_mpigcry_mpi_newgcry_mpi_snewgcry_mpi_releasegcry_mpi_copygcry_mpi_setgcry_mpi_set_uigcry_mpi_swapgcry_mpi_cmpgcry_mpi_cmp_uigcry_mpi_scangcry_mpi_printgcry_mpi_aprintgcry_mpi_dumpgcry_mpi_addgcry_mpi_add_uigcry_mpi_addmgcry_mpi_subgcry_mpi_sub_uigcry_mpi_submgcry_mpi_mulgcry_mpi_mul_uigcry_mpi_mulmgcry_mpi_mul_2expgcry_mpi_divgcry_mpi_modgcry_mpi_powmgcry_mpi_gcdgcry_mpi_invmgcry_mpi_get_nbitsgcry_mpi_test_bitgcry_mpi_set_bitgcry_mpi_clear_bitgcry_mpi_set_highbitgcry_mpi_clear_highbitgcry_mpi_rshiftgcry_mpi_lshiftgcry_mpi_set_opaquegcry_mpi_get_opaquegcry_mpi_set_flaggcry_mpi_clear_flaggcry_mpi_get_flaggcry_cipher_opengcry_cipher_closegcry_cipher_setkeygcry_cipher_setivgcry_cipher_setctrgcry_cipher_ctlgcry_cipher_infogcry_cipher_algo_infogcry_cipher_algo_namegcry_cipher_map_namegcry_cipher_mode_from_oidgcry_cipher_encryptmemsetgcry_cipher_decryptgcry_cipher_get_algo_keylengcry_cipher_get_algo_blklengcry_cipher_listgcry_pk_encryptgcry_pk_decryptgcry_pk_signgcry_pk_verifygcry_pk_testkeygcry_pk_genkeygcry_pk_ctlgcry_pk_algo_infogcry_pk_algo_namegcry_pk_map_namegcry_pk_get_nbitsgcry_pk_get_keygripgcry_pk_listgcry_md_opengcry_md_closegcry_md_enablegcry_md_copygcry_md_resetgcry_md_ctlgcry_md_writegcry_md_readgcry_md_hash_buffergcry_md_get_algogcry_md_get_algo_dlengcry_md_is_enabledgcry_md_is_securegcry_md_infogcry_md_algo_infogcry_md_algo_namegcry_md_map_namegcry_md_setkeygcry_md_debuggcry_md_listgcry_ac_data_newgcry_ac_data_destroygcry_ac_data_copygcry_ac_data_lengthgcry_ac_data_cleargcry_ac_data_setgcry_ac_data_get_namegcry_ac_data_get_indexgcry_ac_data_to_sexpgcry_ac_data_from_sexpgcry_ac_io_initgcry_ac_io_init_vagcry_ac_opengcry_ac_closegcry_ac_key_initgcry_ac_key_pair_generategcry_ac_key_pair_extractgcry_ac_key_data_getgcry_ac_key_testgcry_ac_key_get_nbitsgcry_ac_key_get_gripgcry_ac_key_destroygcry_ac_key_pair_destroygcry_ac_data_encodegcry_ac_data_decodegcry_ac_data_encryptgcry_ac_data_decryptgcry_ac_data_signgcry_ac_data_verifygcry_ac_data_encrypt_schemegcry_ac_data_decrypt_schemegcry_ac_data_sign_schemegcry_ac_data_verify_schemegcry_ac_id_to_namegcry_ac_name_to_idgcry_randomizegcry_random_add_bytesgcry_random_bytesgcry_random_bytes_securegcry_mpi_randomizegcry_create_noncegcry_prime_generategcry_prime_group_generatorgcry_prime_release_factorsgcry_prime_checkgcry_set_progress_handlergcry_set_allocation_handlergcry_set_outofcore_handlergcry_set_fatalerror_handlergcry_set_log_handlergcry_set_gettext_handlergcry_mallocgcry_callocgcry_malloc_securegcry_calloc_securegcry_reallocgcry_strdupgcry_xmallocgcry_xcallocgcry_xmalloc_securegcry_xcalloc_securegcry_xreallocgcry_xstrdupgcry_freegcry_is_securegcry_cipher_registergcry_cipher_unregistergcry_pk_registergcry_pk_unregistergcry_md_registergcry_md_unregisterstrlengpg_strerrorabortstderrfwritevfprintfsyslog__ctype_b_locstrcmpgpg_strsourcegpg_err_code_from_errno__errno_locationstrcpymemcpymemcmpstrchratoisprintfstpcpygetuidmlockgeteuidsetuidsysconfmmapmunmapaccessfopenfgetsfclosefflushfreadferror__assert_failselectwaitpidacceptconnectsendmsgrecvmsgstrcasecmpstrncmpmemmovestrtoulsnprintfstrncpystrcatgpg_err_code_from_syserrorfcntlgetpidtimeclockftruncategettimeofdaygetrusagesrandgetppidlibgpg-error.so.0libc.so.6__fxstatlibgcrypt.so.11GCRYPT_1.2GLIBC_2.1.3GLIBC_2.1GLIBC_2.3GLIBC_2.0b^si ii ii ii $,4DHP`dhlptx|  $048<@DHTX\`dhlx|  ,048<@DPTX\`dhtx| $ $04@DPT`dpt (08@HPX`hpx $04@DPT`dpt 048X\`,04X\`@DH|048lptLPT048|     @ H P ` h x |      $ ( @ H P X                     , 4 8 @ H P X          8 < @ ` x |     $ 8 < @ ` x |        @ H X \ `              @ H P X               @ H X \ `                     $ ( , 0 4 8 @ D H L P T X \ ` d  $ ( @ D H L P T X ` d h l p t x                      4 8 < @ ` t x |                 @ D ` d l t x |               $ , 4 8 < @ H                     @4 `4 d4 l4 t4 x4 |4 4 4 4 4 4 4 4 4 5 5  5 5 5 5  5 @5 D5 H5 L5 P5 `5 d5 l5 t5 x5 |5 5 5 )*      )$-(2,3074;8=<>@JDMHQLTPWT\X^\f`gdhhmlpput~x| US[(tIDX[] hhhhh h($h0(h8p,h@`0hHP4hP@8hX0<h` @hhDhpHhxLhPhThXh\h`hdhhhplh`phPth@xh0|h hhhhhhhh h(h0h8ph@`hHPhP@hX0h` hhhphxhhhhhhhhph`hPh@h0h hhh hhhhh  h($h0US[tSuBt% @PDҋDuƃS]Í'US[0tt 0P҃]ÐUS=(ȜE$9[]US(åE$9[]US'ÂE$9[]US'_E$9[]US'<E D$E$~9[]US'E$9[]USd'E$/[]US$A'̛E EED$E$2EE$[]US 'ÖED$ ED$E D$E$9G[]US&^ED$ED$ ED$E D$E$eE[]US&ED$ ED$E D$E$q[]US$\&EEED$ ED$E D$E$pEE$[]US&ãED$ ED$E D$E$q[]US%kE$SF[]US%HED$ ED$E D$E$y[]US%ED$ ED$E D$E$Au[]USM%ؙE$B[]US*%õE D$E$aF[]US%ËE$pF[]US$hD$D$$R(US$6E D$E$xF[]US$ E D$E$F[]USW$ED$E D$E$F[]US&$ñE$H[]US$ÎE D$E$$J[]US#dE$L[]US#AE$>O[]US#E$*Q[]USp#ED$E D$E$M[]US?#ʗE D$E$M[]US#àED$E D$E$N[]US"oE$q []US"LE$g []US")E$] []US{"E$[]USX"E D$E$/[]US."ùE D$E$[]US"ÏE D$E$ []US!eE D$E$[]US!;E D$E$K[]US!ED$ED$ ED$E D$E$[]USG!ҕED$ED$ ED$E D$E$[]US!ÓED$ ED$E D$E$[]US [E$[]US 8ED$E D$E$蕡[]US| ED$E D$E$[]USK ֔ED$ ED$E D$E$辥[]US ÞED$E D$E$/[]USmED$E D$E$裣[]US<ED$ ED$E D$E$n[]USyED$E D$E$[]USHӓED$E D$E$x[]USâED$ ED$E D$E$y[]USjED$E D$E$[]US9ED$ED$ ED$E D$E$迹[]USoED$E D$E$#[]US>ɒED$ ED$E D$E$[]USÑED$E D$E$&[]US`ED$E D$E$载[]US/E$[]US E D$E$}[]USWE D$E$豤[]US-øE D$E$a[]USÎE D$E$[]USdE D$E$藥[]US:ED$E D$E$輦[]US~ ED$E D$E$蝪[]USMؐED$E D$E$z[]USçE D$E$[]US}E D$E$[]USSE D$E$[]US)E D$E$[]UStd"uE$1E#ED$ ED$E D$E$軺EE[]UED$$U} tEE MEEUSUE$蒽[]US2!u$mEED$E D$E$EE[]USVF!u$EED$E D$E$EE[]USÐ u$EED$E D$E$\EE[]US? u$zE#ED$ ED$E D$E$EE[]US\ED$ ED$E D$E$n[]US$ï u$E#ED$ ED$E D$E$=EE[]USWE$[]US4E$[]USE$蛳[]US$cSu1} tED$D$BE $ $ E*ED$ED$ ED$E D$E$hEE$[]US$ou$E*ED$ED$ ED$E D$E$cEE$[]USE$[]USbE$[]US?ʋE D$E$@[]USàuE$EED$E D$E$Q EE[]USFuE$xEED$E D$E$O EE[]USaQuE$EED$E D$E$GEE[]USÒu$EED$E D$E$EE[]USAu$|EE$EE[]USscuE$0EE D$E$EE[]US ëED$E D$E$|#[]USzu$E#ED$ ED$E D$E$#EE[]US"E$[]UStE$[]USQ܈Au EE$EE[]USáu EE D$E$EE[]US_E D$E$%[]US5uE$gEED$E D$E$zEE[]USPۇE$1[]US-øu$EE D$E$|EE[]USnuE$EE D$E$EE[]USE$[]USm]u$3E#ED$ ED$E D$E$EE[]USàtED$E D$E$@[]USfE D$E$襇[]US<u2ԢD$D$ D$D$5$ՊED$ ED$E D$E$辇[]US$>Ʌ.u;D$D$ D$D$@$bEE$6EE$[]US\E$ȉ[]US9u EE D$E$YEE[]USlE$[]USIԄ9u$E#ED$ ED$E D$E$蠌EE[]US|ED$ ED$E D$E$׉[]USDE$6t[]US!E$r[]USscu$9EED$E D$E$̓EE[]US"íE D$E$[]USÃE D$E$[]USYE$#[]US6E$%[]USE D$E$&[]US^E$'[]US;ƂE$5[]USãED$ ED$E D$E$8'[]US kED$ ED$E D$E$)[]US 3ED$ED$ ED$E D$E$*[]USi ED$E D$E$,[]US8 ÁED$E D$E$*/[]US$ ÒEEED$ ED$E D$E$4$[]US TED$ ED$E D$E$3[]US ED$E D$E$}?[]US` E$M@[]US= ȀED$ ED$E D$E$L@[]US ÐED$ED$ ED$E D$E$@[]US QE D$E$E[]US 'E$F[]USy E D$E$G[]USO ED$E D$E$G[]US éED$E D$E$H[]US xE$E[]US UE$E[]US 2ED$ED$ ED$E D$E$X[]USh ~ED$ED$ ED$E D$E$0X[]US) ô~ED$ED$ ED$E D$E$G[]US u~ED$ED$ ED$E D$E$|I[]US 6~ED$ ED$E D$E$K[]USs }ED$ ED$E D$E$L[]US$; }E D$ED$ED$ED$ ED$E D$E$\$[]US$y}E D$ED$ED$ED$ ED$E D$E$^$[]US$,}E D$ED$ED$ED$ ED$E D$E$.a$[]US$T|E D$ED$ED$ED$ ED$E D$E$'c$[]US$Ò|E$EEu$EU EEE$[]UED$$ UE D$E$US$ |E$E}u$EUE EE$[]US0û{ u7ԢD$D$ #D$D$$T˃ED$E D$E$6L[]USJ{ u$EED$E D$E$JEE[]USnz^ u7ԢD$D$ 2D$D$$ E D$E$J[]USÏz u7ԢD$D$ DD$D$$(蟂E D$E$J[]US%zED$E D$E$^[]USiyY u7ԢD$D$ ]D$D$$~E D$E$K[]US$ÊyE$D$E D$ED$ED$ED$ ED$E D$E$֮$[]US6yED$ ED$E D$E$([]USsxE$;[]USPxE D$E$b[]US&ñxE D$E$,[]USÇxED$ED$ ED$E D$E$+[]USHxE D$E$b[]USxE D$E$[]USiwE D$E$[]US?wE$5[]USçwE$*[]USÄwE D$E$[]USZwE$ []US7wE D$E$[]US wE D$E$>[]USXvE$[]US5vE$O[]USÝvE D$E$[]USsvE$=[]USPvE D$E$5[]US&vE D$E$5[]USquE$u[]USNuE$[]US+öuE$[]USÓuED$ E D$D$E$艘[]USZuE$譙[]US7uED$ E D$D$E$r[]USstE$W[]USPtED$ E D$D$E$`[]USâtE$a[]Ë$ÐUH|tES]US_tStSU$ЉEEEE[]U%tE SES]UStsE$JD$ED$$[]US:s} uE$jE St(ouSSE D$ED$$ыE D$D$ pD$D$R$$x$1E $&${f%UsESE S]UrES]UrS;E]US$(órSt+SSED$ E D$ED$ $EE}}#} }}}2t=}dtc}(tD$ D$D$$yD$ D$ D$$MD$ D$D$$!ED$D$$ED$E D$$A}(t}2u<ڣD$D$ D$D$$vd)$[]U(EEED$E D$E$3USYpED$E D$ ED$D$$2US$âpED$ED$E D$ ED$D$$2SqU(E EED$ED$$ U(EEED$E D$$ XU(E EED$ED$$+US$QoE EED$ED$$(US$åoE EED$ED$$2U(E EED$ED$$dU(}t E EED$ED$$gUS$o}tEtED$:$s}tTE EED$>$tmEED$C$OEm}u׃}t$-$[]UTEEE@EEm}uE@E}~ E$Ë $US$$nESuwǃSE}u?S$e)RE}uvE}u E}u LD$D$yX$$[]USÄmSudD$$ )k[]US$BmEE<0uSE%t,EjUEE0EEE%uU E}xEEEEEE$[]UE D$E$"E}t E<.t E`EED$E$E}t E<.t E.EED$E$E}u EEEEUSDXkE}u EEED$ ED$ED$E$E}u EE؉D$ E܉D$ED$E$E}u EUE9fUE9u UE9RUE9uUE9u UE94UE9u2UE9u(UE9uED$E$7xEEEEȃD[]UWVSL6j}̍@󥍃D$դD$E $EЍD$)D$E $EЍ6D$JD$E $EЍXD$D$E $EЍD$E $ED$D$E $ELME썃D$E $EE2ED#Et EDЉD$D$E $EЃEEDЅuÍťD$E $Eet EyEnbet EyEnED$ ED$ǥD$E $EЃL[^_]UStiEE E}/ EEܥXM7N8EU7]o$7XYǃSEU BE Ћ$XViE][NV$U9pV$U$[V$U6U BE Ћ$888U BE Ћ$U BE ЋS ЉSU BE ЋҋS!ЉSq#gSYEMS?E3S%$d5ǃS\SU BE ЋL$$I~Eă}$57$<EU BE Ћ$5y$4U BE Ћ$~5KU BE ЋEȃ}t E EEȉD$E$' dEabSESuǃSct $i5cEv($iE]U BE ЋE̋U BE ЋEЋU BE ЋEԋU BE ЋE؋U BE ЋE܋U BE ЋEU BE ЋEU BE ЋE/u EİED$ED$ED$E܉D$E؉D$ EԉD$EЉD$Ẻ$h6EU BE ЋEU BE ЋEU BE ЋEu EİBUED$T$E$q6E$U BE ЋEE$6E=Eĉ$Ot[]UED$$U} tEE MEEUED$$ UE D$E$UE EED$E$EEUS&cE$[]USxcE$[]USUbE$[]US2ýbE$x[]UE D$E$USÀbE $;D$E$[]USNbE$ $[]US#b^t$4^ESE SESESES[]US7a]t$;ESE S[]USzaSu E%y]tǃSE SEE[]US'aEE 4u6u-StSU$ЉE;E$FE+StSU$ЉEE$BEE}u*达u 賾 訾$NEUEE[]U(EED$D$E$EU(EED$D$E$EUS}`wt E+StSU$ЉEE$REE[]U]US$ ë_StSE D$E$҉EE D$E$SEE}u}u r E$[]US;_}tAFEStSE$ E$!G}t ‹E[]US$Q^EE E} t$Eu ;Etͼ E4E$+E}tED$D$E$EEE$[]US$Y^EE E} t$Eu ;EtJ E4E$E}tED$D$E$=EEE$[]US$K]EEE$EE$tE$WEE$E}tED$E$E$[]US$T]VFYu.St$SSD$ED$$хu,$һD$$%E$E}tE$[]US$B\xXuPStFSEE$t EESUT$U T$$Uu胺$)D$$|E D$E$E}iE$[]UVS \b Xu.St$SSD$ED$$хu+$`$膺t$$E$cE}tE [^]US$Ä[EE E} t:Eu ;Et*u j$D$$cE$EED$D$E$XE$[]US$lZEE E} t:Eu ;Et* ݸ$胹D$$E$wEED$D$E$˹E$[]US$jZE$谺EE$2E5Vu-St#SESD$ED$$хu>}t$EE$袸UT$$E$E}PE$[]USÚYUt E S#EEE[]USaYE D$E$-E D$E$;E D$E$sE D$E$ '[]ÐUSuY#Ex4ҸEuE;EE< u$ME< u$0E< u$E< u $lE<u $REu$8ED$$ED$$m E} []US$+öWE}u$C?EEEEE}t}t6}taE#D$T$$$E}tmE#D$T$/$D$ED$E$*EE#D$T$;$vED$"D$E$F$JEE)EED$ #D$T$J$EE}$[]US$?V}u EUEEEuE$E1E<u!E<uE$EEEE$[]US45U}u$-EE}x }} u$-E}u<}u6E UT$ D$D$$5E}u%EE}u}tE $tEEU D$D$D$ED$ T$D$E$jEEtEE(UE}t E $E$ EE4[]UED$$ UE D$E$U} tEE MEEUD$ED$ ED$E D$E$=US4pS}E$EEFEEE؃}t6}t0}t(D$ED$E$ԳEEEEE}uEEUE)ȉEEEm}uE$4[]US0S_D$D$;o$USsRvD$D$Ko$USARD$D$Xo$USÚRD$D$ho$UShRD$D$so$RUS46R}u E$}uE $iEEEE<E<EEED$ED$E$EE;EQED$E D$E$;0EEEE<u7ED$ED$E$腱UEEmJE<uE:E<um*Eu D$D$o$E}gE‹Ef)fEE$GE}u EEEED$ED$E$跰EEEEE$E]EE@@`?`$vu&@`$F@```;LrDž`L$ LE)ȉ‹E DžHZdt L<| Džd T!LEЋED$T$E$<EЋED$T$E$EЋED$T$E$EEEE<E}E;Er E1E EED$JD$Eʉ$wEʉ$蜁EE}tPE;Er EEʉD$E$aEED$ED$E$!EEEE 8D$D$o$迯E@} t%E}tE;Er E7E E}tE;Er EEEEEEEd[]U(EEEE}uEE}uEE$`UE}u E+E<(t$*‹EEEE} t/E;E r'UE$‹EE}E<:uP} t2EE;E r'UE$‹EE{EEEEEVE EE D$E$wEE$[]US$"íSEE}Ecb$[]US$kT$E}tGE$bD$($̓E$bD$`D$$ bb$[]Uŕ T]U觕T]US6u*D$ D$D$$ڒt1ED$D$ D$D$$$*B\Tu.ǃTED$ȱD$$ a[]USou ETEXEEE[]U联}w_E8EKE@E5E*E E,E 5EEUS襍0$u E=&Tu$3TEdE[]US;u ETEE[]US}qu E6sTt Tu EEEEE[]UST菌}u$$}t TE VEԃ}tEE VE؃}t WE VE܃}tEE ZE_D$E$buE $=(EfD$E$buE $KEgmD$E$zbuE $"E8rD$E$QbuE $YE VEEEEEEE䍃mD$E$ bu yE VEmD$E$atEE fEEԉD$ E؉D$E܉D$ED$E D$ED$ ED$ED$$ԎT[]US$蜊'EEELD$ED$$OE}tE$_EEELUT$ D$D$_$}}tEEELoE$[]US$kEEE`D$ED$$E}tE$^EEE`UT$ D$D$f$}tEEE`oE$[]US$$ïEEExD$ED$$E}tE$^EEExUT$ D$D$m$}tEEExoE$[]US$hEEED$ED$$vE}tE$b]EEEUT$ D$D$r$I}tEEEoE$[]US$謇7$E}tE$\EEED$ D$D$$}$[]U]UEE2t $E$]uME$ u>E$u/&u&E$[uuEE9t E$EUSD菆]}t EEE؉$B}tEE E܃}tEE VE}t ̲E VE}t زE VEE܉D$ED$ED$E D$ ED$ED$$}tEE E}tEE VE}t ̲E VE}t زE VEED$ED$ED$E D$ED$ ED$D$$ fXD[]UVS0 ×ETETE}EEܳ}t}t }E}t }t}usEj}t }t}uXEO}t}t }t}u7E.}t}t }t}uE }uE}t ET$}t$諅tO}t EU MEE$ƋE$UT$ t$D$T$ч}u=E$eƋE$Xt$ D$|D$$ VKB}t}u6E$ƋE$t$ D$D$$ mV0[^]USÞD$$ >V$BW}UUWVSԂ_E EEEċE@EȋE@E̋E@ EЋE@EԋE@E؋E@E܋E@EEEEMUEEUEEUEEEEEEE}~EEUTE}~}ED$$rƋED$$S1‹E 1‹E‰pED$$ ƋED$$1‹E1Ћp‹EE}?ED$Eԉ$D$ Eԉ$u1D$Eԉ$`1UE3E#E3E‹E싄 ‹E싄ED$Eĉ$D$ Eĉ$1D$Eĉ$1EȋU!‹E E#E ЍEE܉EE؉E܋EԉE؋EEЉEԋẺEЋEȉE̋EĉEȋEEEăE}?EUċEE@UȋEPE@ŰEPE@ UЋEP E@UԋEPE@U؋EPE@U܋EPE@UEPČ[^_]UEM ȉEE]US$EE@($D$D$E$E@ EEEEEEEE@$EE;EsEEEeeE EE@$7=EP$ED)EP$EP$ED)EP$E@$7~tEP$ED)EP$EP$ED)EP$E@$?~D$D$E$E)D$8D$$QE‹EPaE‹EPbE‹EPcE‹EPdE‹EPeE‹EPfE‹EPgE‹EPhE)D$E$E)EE‹EEE‹EEE‹EEE‹EEE@‹EEE@‹EEE@‹EEE@‹EEE@‹EEE@‹EEE@‹EEE@‹EEE@ ‹EEE@ ‹EEE@ ‹EEE@ ‹EEE@‹EEE@‹EEE@‹EEE@‹EEE@‹EEE@‹EEE@‹EEE@‹EEE@‹EEE@‹EEE@‹EEE@‹EEE@‹EEE@‹EEE@‹EEE@‹EEUB( B($[]USt{Ë$PE}u E+Eg jE@gE@rnE@($t&EiEE@EEm}uE$L[]U(E EE@($E@$@u.E)D$E$'E@$E@ PEP }E@$$EH$EET)QEP$Em}t E@$?~D$D$E$@}tr3ED$E$E@$E@ PEP m@E@}?w$EH$EET)QEP$Em}t E@$?~US$wÎE$E@($D$$E}uE$JEEiD$@D$E$GE)D$ D$E$*E$E)U)D$ D$$KE$} t E E)EE$[]US4vÛ D$E$JE}u EyED$E$E}uE$QJEGEE$sKE}u;E$JE$E ED$ED$E$ED$ ED$D$E$KE}uE$ZIE$Kt"E$IE$YEE$~IED$E$E}uE$EQE;E vE$GGE*ED$ED$E$?IE$EE؋E؃4[]ÐUS$QtExTt7DTt DTЉE}tEEHT T$ЉEEEE$[]UWVSsq} E}tEExTuEt E<@T%t5Et,@TE9u@TЋE%9t E<hE_}tHE@tE@t E@u E-2E@TǃxT ǃxTEE[^_]USraE} tPT T$ҋEt} uHTU$ЉE} tTT T$ҋE[]USfrxTtD$E$aEEEE[]USräxTtnLTu EPT T$ҋEuTT T$EgTT T$ҋLTE$҉ECEt*#D$ D$;D$A$_EEEE[]US$CqxTt7D$E$>E}tEEVPTU$ЉECEt*\D$ D$;D$A$DEEE$[]US$p/xTt7D$E$E}tEEWTTU$ЉEDEt*qD$ D$;D$$ DEEE$[]USpÏxTt+XTt!XTED$E D$E$҉EED$E D$E$CEE[]USo#xTt+\Tt!\TED$E D$E$҉EED$E D$E$BEE[]US$,o÷xTt9`Tt/`TED$ED$ ED$E D$E$҉E*ED$ED$ ED$E D$E$3DEE$[]USn/xTt+dTt!dTED$E D$E$҉EED$E D$E$gCEE[]US8nxTt+hTt!hTED$E D$E$҉EU ED$T$E$KBEE[]USmWxTt+lTt!lTED$E D$E$҉EU ED$T$E$_@EE[]US`mxTt+pTt!pTED$E D$E$҉EED$E D$E$@EE[]USlxTt+tTt!tTED$E D$E$҉EED$E D$E$BEE[]ÐU]US{lD$D$$oUSIlD$D$$oUSlâյD$D$$oUSkpD$D$$ZoUVS0k=EE[E􍓠@uE􍓠BE􍓠@uE􍓠BE􍓠@ uE􍓠 B E􍓠@$uE􍓠RB$E􍓠@(uE􍓠B(8tE􍓠D tTE􍓠LE􍓠4E􍓠DD$L$ t$D$T$#EE}uE􍓠}t D$D$5$m0[^]US4isEEE EE@EED$E$ ?E}tIE*EED$E$>EEEEt}tE4[]US4JiEEE EE@EE}tGE)EED$E$f>uEEEEt}t‹E4[]US$hQT!D$ED$$EE$[]US$hT"D$ED$$EE$[]US4LhEt$<E|T$} tE E TEED$ED$ ED$D$T$E|T$}uUEE@‹EE$UEE4[]UED$$U} tEE MEEUED$$ UE D$E$USgÐ|T$E$r|T$([]US$fQE}tFD$D$E$ETD$$|E}t!E@tE E$E |T$E$[]US$$bïE|T$Tu;ǃT|T$2|T$ETD$$E}tHE@@E}uED$#$ifE$|T$EEED$=$3fE$[]US$DaE|T$Tu[ǃT|T$R|T$ETD$$E}tHE@@ E}uED$R$eE$0|T$EEED$=$SeE$[]US4d`EEEEEEE|T$TuQǃT|T$H|T$E TD$$E}t5E@tE E$9E@EE@ EE |T$}uEtE }}ElEP9tEP 9u[EGREP$R9tEP(9u2EG)xu$yuEGEG}8E@E}tED$$tEED$$$tE}u1$1EEEtEƒ)ЉEUEE}t EBFEd $EUԉUE)щʋEPUEBUEB UEBUEBUE BUEB,UEB0E w0U싃BU싃B U싃B$U싃B(}t-}t'|T$E$|T$}uEEEEU؉E$4[]US$]æ}E=BFt"E=d $tD$$?]E|T$wE@$D|T$E@EEEE@EEEm}uEU)Љ$q$[]UVS Y\E@ HUpED$E D$$щE}u1E@ HupUpE@ @L$t$$0E$ [^]US[dE@ @ U4D$D$$/} E@ @ ;EtTE@ @ D$ED$ȶ$_D$D$ D$D$$E@ @ ;Es E@ @ EE4UT$U T$$/E@T[]USZ}E@ HUpE@ @UpL$D$$/E@ @ U4D$D$$o.E@ @ UDD$D$$L.E@ @ UXD$D$$).[]U(E>E@ HUpED$E D$$ыE@ @ EE@ @ E EE;ErU(E>E@ H UpED$E D$$ыE@ @ EE@ @ E EE;ErUVS@YE@ @ EEuEE@0tE;EvEuЅumE@$tgEp$E@0U4MpD$ED$ED$ E D$T$ $֋EEEE@0EEE EE4EE#EM EEE0ЈEEE;ErՋE@ HUpE D$E D$$ыU4ED$E D$$-EEE@0uEE EE;E\E@0E;EEuЅuEEEuЉEE)E E4EE=EEEEEU EE EU E2EEEE;E|EU EEEE;ErE@ HUpE D$E D$$ыU4ED$E D$$+@[^]UVS@WÚE@ @ EEuEE@0t@E;Ev8mEuЅumE4MDUT$D$ $i+E@(tIEp(U4MpED$ED$ E D$T$ $֋EEEEEE EUDED$ED$$*E@ H UpED$E D$$ыE4EE#EM EE E0ЈEEE;ErՋUDM4ED$T$ $p*E@ @ EE@ @ E EE;E>E@0yE;EmEuЅuEEEuЉEU4MDED$T$ $)MEEU4L$D$$)E@ H UpED$E D$$ыE4EE#EM EE E0ЈEEE;E|ՋUEM T$E D$ $G)EEMEE ET4EE;ErE@ H E4UpD$E D$$ыEDEE#EM EE E0ЈEEE;ErՃ@[^]UVS@SnE@ @ EEEEE@T;ErdU4E@ @ ‹E@T)ȉE7U E0ȈE E EEmE@TPEPT}uE@TtbE@T)EU4E‹E@T)ȉE3U E0ȈE E EEE@TPEPTE@TuËE;EE@EuEEpU4MpED$ED$ E D$T$ $֋EEE EEEEE)ExE@ pE4U4MpD$T$ $֋E4EE(U E0ȈE E EEEE;ErЋE)EE;EsE;EU4MDED$T$ $&E@ pE4U4MpD$T$ $֋E4EE(U E0ȈE E EEEE;ErЋE)E}U4MDED$T$ $&E@ pE4U4MpD$T$ $֋UEPTE@T+E‹EPTE4E(U E0ȈE E EEm}u҃@[^]UVS@P5E@ @ EEEEE@T;ErlU4E‹E@T)ȉEEEEEEE0‹E E E‹EEmE@TPEPT}uE@TtpE@T)EU4E‹E@T)ȉEAEEEEE0‹E E E‹EEE@TPEPTE@TuE;EE@ EuEEp U4MpED$ED$ E D$T$ $֋EEE EEEEE)EE@ pE4U4MpD$T$ $֋E4EE6EEEEE0‹E E E‹EEEE;Er‹E)EE;EvE;EU4MDED$T$ $5#E@ pE4U4MpD$T$ $֋E4EE6EEEEE0‹E E E‹EEEE;Er‹E)E}U4MDED$T$ $"E@ pE4U4MpD$T$ $֋UEPTE@T+E‹EPTE4E6EEEEE0‹E E E‹EEm}uă@[^]UVS *MõE@ @ EE@T;Er_U4E@ @ ‹E@T)ȉE2EE0‹E E EEmE@TPEPT}uE@TE@T)EU4E‹E@T)ȉE.EE0‹E E EEE@TPEPTE@TuU4MDED$T$ $ E@ pE4U4MpD$T$ $֋E4EE#EE0‹E E EEEE;ErՋE)EE;Ej}U4MDED$T$ $F E@ pE4U4MpD$T$ $֋UEPTE@T+E‹EPTE4E#EE0‹E E EEm}u׃ [^]UVS JÀE@ @ EE@T;ErYU4E‹E@T)ȉE2EE0‹E E EEmE@TPEPT}uE@TE@T)EU4E‹E@T)ȉE.EE0‹E E EEE@TPEPTE@TuU4MDED$T$ $E@ pE4U4MpD$T$ $֋E4EE#EE0‹E E EEEE;ErՋE)EE;Ej}U4MDED$T$ $E@ pE4U4MpD$T$ $֋UEPTE@T+E‹EPTE4E#EE0‹E E EEm}u׃ [^]UWV0EE@ P EѺЅugE@ HEXUpD$ED$$ыE@ @ E.MEDXPETXUEDXu m}̋Eu EEE@ P E׺D0ȈEE;E=0^_]UED$ ED$E D$E$US4GLEE@,E}EEdE@ P EѺЅu7E@ P EѺD$ ED$E D$E$E-E@ P EѺЅtE@ @ ;Es2E@0t%ED$ ED$E D$E$<8E-,ED$ ED$E D$E$ED$ ED$E D$E$MED$ ED$E D$E$E@ P$MpED$ ED$E D$ $豶u$`u;(D$D$ D$D$$FEG;E;E t3ED$ED$E $E@,D$@$@JE4[]US$E}u(U M ED$ T$L$E$EE@0tE@ @ EEEM;Mv EBxE@,t&E@,u?E@0tE@ @ ;Er$E@ P EѺЅt E-#UM ED$ T$L$E$E}t } tED$D$BE $[E$3$[]US4gDEE@,E}EEE@ P EѺЅu7E@ P EѺD$ ED$E D$E$E-E@ P EѺЅtE@ @ ;Es2E@0t%ED$ ED$E D$E$d8E-,ED$ ED$E D$E$ED$ ED$E D$E$(ED$ ED$E D$E$E@ P(MpED$ ED$E D$ $Wu$]u;(D$D$ D$D$$EG;E;E t3ED$ED$E $DE@,D$$FE4[]U(E}u(U M ED$ T$L$E$EE;Es EBxE@,t&E@,u?E@0tE@ @ ;Er$E@ P EѺЅt E-#UM ED$ T$L$E$EE$%UVS\AE@0E@Tt}E@ P E@T)u4U4E@TL$t$$E@TUDE@ @ ‹E@T)ƉU4L$D$$E@T[^]UU ED$T$E$2UU ED$T$E$USd@} t2E@ @ ;Eu$E@ @ UXD$E D$$B} t}u%E@ @ UXD$D$$$-ZEEE[]US$?SE} >E UED$T$E$ EEUT$D$E$E$WqE$a}t/E@0t EHBE@0ƒEP0,E@0ƒEP0}t/E@0t EHE@0ƒEP0E@0ƒEP0}u }t}t$ FEE$}t5E@ @ ;Eu'E@ @ UXD$ED$$X}t}u(E@ @ UXD$D$$$E-E@@t4E@PEpD$ D$D$$҉EE<E@ @ ;Ev EBEEE@TE}u E@ @ EUE@ @ 9v*зD$ D$D$$AE‹EEU4E@ @ ‹E)ȉEEEEEm}uE=E$EE$[]UEE=E$cUEE E}tb}}t}u}u E E$&E}t}wEEzE q}u}u E \E$E}t}'w UE5E ,}u}t E-E$EE=E$jU(ED$ D$D$E$tEEU(ED$ D$D$E$tEEUS2;ýE|T$TuIǃT|T$@E[]US$:fE|T$qTE D$ED$$vE|T$E$[]US4~: EEE|T$TuǃT|T$~|T$ETD$$E}tE@u E@ E|T$.}t)Et EED$E D$E$҉EqE }td}t E@t"}t E EEE EED$ 5D$ED$<$EЃ}t'|T$E$諤|T$aE$w4[]ÐUS8|TD$D$ DD$D$vt$E[]US8-TD$D$ }D$D$t$ϱE[]USS8ެTD$D$ D$D$t$耱E[]US8ÏTD$D$ D$D$t$1E[]US7@TD$D$ D$D$t$E[]USf7TD$D$ D$D$t$蓰E[]US7âTD$D$ ȹD$D$t$D[]UVS06REEE@ uExRB E@$uERB$E@(uESB(E@,uEeSB,E@0uESB0E@4uETB4E@8uERTB8ELE4EDD$L$ t$D$T$EE}uEI}t عD$D$t$l80[^]US$4IEEE EE@EED$E$ EEED$E$ E}t Euփ}$[]US$D4ϨTVD$ED$$`EE$[]US44ÒEt$<ET$} tE E TEED$ED$ ED$D$T$kET$}uUEEPEEEE4[]UED$$U} tEE MEEUS2ÊT$E$lT$"[]US2KE$(EEEu݃[]US$2E}u ET$ TuvǃTT$T$E$E}tE@EE$舝T$>EEE$[]US$1^T$pTuǃTT$T$;ETD$$yE}tE@EE$ ET$E$[]US$(1óET$辿Tu*ǃTT$6T$艿ETD$$ǛE}tPE@EE@t E@EEEE}t EuEEE$T$謿E$[]US$G0ҤT$ETD$$"E}t)E@uE@ƒEPE$xT$.$[]US$/WET$bTuǃTT$ھT$-ETD$$kE}tcE@EE 4u E@tE tE@u E)E@tEE$艚ET$6E$[]US$.\ET$gTuǃTT$߽T$2ETD$$pE}tE@@$9EE$ЙT$膽E$[]US$!.ìET$跼Tu#ǃTT$/T$肼ETD$$E}tE@@ $EE$ T$ּE$[]US$q-ET$TusǃTT$T$һETD$$E}tE@@$EE$pT$&E$[]US$,LET$WTuǃTT$ϻT$"ETD$$`E}tE@@$)EE$T$vE$[]US4,ÜET$觺TuǃTT$T$rETD$$谖E}E@ E}tGE@t=EPE D$ED$ED$ED$ ED$E D$E$҉E0E@P ED$ED$ ED$E D$E$҉EE$蚖T$PE4[]US$*vET$聹TuǃTT$T$LETD$$芕E}t&E@P$E D$E$҉EE$T$虹E$[]US$4*ÿ$Etn裚ueED$$/E"EED$$EE$;E΋ED$$T$SETD$$葔E}tCE@EEP(ED$ED$ ED$E D$E$҉EE$ϔET$|}uT$CtD蛙u;E"EE D$$EE$ ;E΋E$[]US$(HE $CED$$-E"EED$8$JEE$;EE"EED$$EE$:;E΍T$襶ETD$$E}tCE@EEP,ED$ED$ ED$E D$E$҉EE$!ET$ζ}u0$QBt uE D$@$AE$[]US$3'þ$Btn袗ueED$H$,E"EED$8$EE$;E΋ED$$T$RETD$$萑E}tEE@EE@ E} t E@ E E@EȋEȉEE$ D$$3E}u$NEԃ}uP}t%ED$ ED$ED$E؉$EE%ED$ ED$ED$E؉$9EԋE؉$>}t4E$2T$%E$T$諬UEUEEԉEET[]US4.ùED$ۺD$E$M?E}u EA(D$E$CE}uE$L=EDD$E$GE}u"E$=E$=EAD$E$@u_E$1E$EẺD$ED$E؉$CE}Ẽu#D$D$E$uoẼu,D$D$E$eu E;Ẽ u'D$ D$E$1uM EH6m}2E؉$O9D$Eԉ$>E؃}u EDE$-D$E؉$BE}u EAEԉ$8E؉EET$E$ET$~}u EqE@E܋E܋@EE$D$$-E}u$.E$D$ ED$ED$Eԉ$IEЋEԉ$'8E؉$8E$,}t4T$*E$T$谦E$,U EUEUEEЃD[]US#îEEEEE}uEEED$bD$E$9E}uRD$D$E$A‹EEt Dž DžAD$D$E$8Ẽ}Ẻ$:EED$ED$Ẻ$a@E}Eu*D$D$E$u EhEu*D$D$E$u E6E u'D$ D$E$uMEm}2Ẻ$5}u }uED$gD$E$m7E}u%D$lD$E$G7 DžM}}0Єt EA}t EH}t}t}u EF}tA}t;D$D$E$w?‹EEEA}}}EE EED$D$E$N>Eԃ}tEu EATEPE9wEu EB4E$(EЃ}uS$E EUEBEUEBEUE)ȃE}*QD$ D$wtD$r$ ED$$?XEEEEEEuEEE;E|}EPHEED$$WEE5EEuE܉U؃mEEEEtEE;E}}uE$'DUEMЉT$E؉D$ $UEEE؉$l'UEBEUEMЉT$EԉD$ $UEEUE9t*QD$ D$tD$x$UED$T$ EЉD$D$E$#EЉ$&}}}E$5t EA~ED$D$E$z;E}tEu EAHEE EECE@$‹E9u$UE@T$ED$ $tEE@uE@tEDE[E$$E}u E;ED$ED$E$EEE$KsEE$p%EdE$"E}u E(ED$D$E$8:E}tEu EAED$ $D$D$ E$跉t EEE;Et EF}tEEPE9v EBE$y#E}u$E]EUEBEUEBEUE)‹E)ȃE}*QD$ D$tD$$UEET$D$$UEEUEBEUEMT$$D$ $6UEEUEMT$ED$ $ UEEUE9t*QD$ D$tD$x$UED$T$ ED$D$E$oE$#EFE$B.E$7.E$,.}uUEȉE[]UWVS\t EEEEEET$TuQǃTT$]ED$ EĉD$D$E$?Eԃ}Eu*D$ D$GtD$$E@E؋E؋@t E؋@EEEẼ}t EuE؋E̋E؋@EЋE$ED$D$ ED$T$E $Eԃ}HEЉ$D$$!Eȃ}u$BE UMċuE@ljT$L$ t$EȉD$<$wEԋE$E}EЉ$tEẺ$fUЍEE$}EEE܃}u$E_D$ D$E$ EẺD$E$EE8E(EEEEED$E$EEEEuD$D$E$\E$]E}u$EEEUEEȉEE;Er܋ED$ E܉D$D$E$6UEԋE$A}t D$D$t$ E܉$EątEĉ$Eĉ$}tEȉ$Eȉ$Et'T$ϻD$E$EME‹dEEE‹duD$E$ED$TD$E$UE܉);ErE$bT$ąE$ 0[^]US4SjEEET$ۄTuGǃTT$SED$ ED$D$E$5E}Au$ED$ ED$D$E$ E}t EgE@EEH8UE@T$$щE􍃐T$%E$`T$諄E$E$ EE؋E؃4[]USt*õiEEEEEET$蝃Tu ǃTT$D$ƺD$E$Eԃ}u D$D$E$Eԃ}u D$jD$E$Eԃ}u D$D$E$Eԃ}u EEԉ$!E؋Eԉ$E؉EED$Eԉ$VE}T$~E$rET$}E@E܋E@ EE܋@E}D$D$EЉ$Z}t,E@t"EHUЋEԉD$$хq EEED$ED$Eԉ$JE؃}3ẺD$D$E؉$'E} ŰET$D$ D$D$E$CE$xUЉD$ED$$bE̋UЉD$ED$$bE؉$UD$TD$$bEEE } u$1E } tHED$$gD$D$E $EЉ$`Eԉ$ME E3E$E؉$/EЉ$`Eԉ$EEt[]USyfET$Tu{ǃTT$臀E t$} t}t E-E $E=E$[]US4peEE Eԃ}_EE}t EEEE؉E}t E-$ED$E$ EET$~TueǃTT$qT$~ETD$$[E}tE@@EE$j[T$ UEgE$EUEOE$vEUE7E$EUEE$EUEE=E܉$4[]USBcET$}TuDǃTT$P~E[]US$vcET$}TuǃTT$}T$L}ETD$$YE}t U EET$}E$[]USIbT$|E$YT$l}[]US$ ÕbET$|TE D$ED$$YET$}E$[]US48bEEET$5|Tu衶ǃTT$|T$|ETD$$>XE}tE@u E@ E􍃐T$]|}t)Et EED$E D$E$҉EqE}td}t E@t"}t E EEE 3EED$ D$ED$I$EЃ}t'T$ {E$WT${E$4[]US4#î`T$zTu,ǃTT$8{EEEETD$$VE}u E?E@E} t+E@$CE}u%$˾ET}t+E@$E}u$蚾E#} tU E}tUEEE$V}tE$6E$+E4[]ÐUS$h_\[t$<_EQ$E}uJ$E"EE@UEEEEE$[]UED$$U} tEE MEEUSÙ^EbEU@t?EU@$EU$EE@;Ew[]US ^}t#E$OE$E$[]US4?]U $CE}u轻$=EU D$D$E$跼EEUE$\EUE@$E}t}u*($EE$9E$VUE@UUEUUEBEE;E 9}uUEE}t[}tUE9UE@$UE$EE;E rE$E4[]US${\EWt$<E$dE}u޹$^ECE PE ED$T$ $E}uE PEPUEUE}t E$EEE$[]UE@]USD9[EEWt$<"E.E t$-!EE tCM E$EE$eE}t}u˸$KEE.EUD$E$躼tEE@;EwNjE@;EvdEU@EU@$REU$gE@P‹ET$$E}uԷ$TEE;EtUEE@PEPEUM̃}tEEUUЋUЋẺEUMԃ}tEEUU؋U؋EԉPEUE BE}tE$0E$EEȋEȃD[]UED$$ UE D$E$US$ÐXTt$<EE t$-EE.EUD$E$ltEE@;EwNjE@;Eu$%EqE t=EU@$iE}u/յ$UE*EU@EUEEEEE$[]US$eWEEKSt$<NEiE t$-ME)E@;Ew$-.E E }t?EU$E}uҴ$RE}t=EU@$ E}u茴$ Et}t0}uEUEEEEU}t1}uEU@EEEEUE}tE$!E$EEE$[]UVSP*õUEEEEQt$<EE}t3!EE$诵EEEEEuϋEE}uEE$EEJD$EԉD$ ED$D$E$uE܃}u Eԉ$.EEEE;Er}E$EEEEEE}}t EEEEԉ$xE؃}h}tE܉$+EEEE"EED$E܉$LE}u$SEEЉD$D$E$)EEЃ$E}ud$EEЉD$ED$E$YEED$D$E$yE}u$SEZUԋED$ ED$D$$yE؃}u0EEE$EEE;E}uUԋEE;E t E܉$]E$RE$E$}t Eԉ$E؉EȋEȃD[]USDO} CK6EE $EEED$ED$ ED$D$E $@E}t$ED$ ED$ED$$װE}t$MEE̋EEЃ}t E Eԃ}tEE E؋ẺD$EЉD$ EԉD$E؉D$$E$EEE;EE$}D[]UE D$E$US ØME$E$3EE@[]US$UMD$D$E$耬.I`} t0} t*D$ D$xʽD$н$C}t0}t*D$ D$yʽD$$ UE UEBE E}t }toEE}t }t0UBEЋEPUBEЋEP UBEЋEPUBEЋEP bEE}t}t*NUBEЋEPUBEЋEP &UBEЋEPUBEЋEP $[]U(EEED$ ED$E D$E$4US$ÇKEt*KD$ D$ʽD$`$EE@E}t}!>E@E@ UE@T$$@E}u$EE@;Et EPEE@ UED$E D$$تEP E@ EE $etE$*EE$E}uh$ESED$E D$E$`EPEEP E"EHEP ED$E D$$щEE$[]US$JIEt*D$ D$ʽD$$EE@E}t}t^~E@ +E EEEE;EvEEEEEPE ‹ED$T$E$oUEE"EHEP ED$ED$$щEE$[]US4 ]HEEDž D$ D$ED$E$E}utuED$E$E}u臦$E@E;EtEE싕EMT$D$ $fEH}uUEU E}t E$E4 []U( EDž D$ D$ED$E$E}u=t3D$D$E$E ЉE}u E늋EUSDRGEEEEEE؉D$D$E$E}tE؉D$ED$E$詨t$S ED$E D$E$yE}u$SEE$EmEԉ$ E܃}bE<ED$E$E}u$SmEE؉D$D$E$E}u$S6ED$D$E$dE}u$?EE؃$ME}uǣ$GE|E؉D$ED$E$菤EEUԋED$ ED$D$$E܃}u0E$>EEEEE;E}uUԋE}t,Eԉ$E$;E$E$E$E܃D[]UVS@4ÿDEEEE$IE܋E$E}u薢$EEUEUEEUEUE4EUEE;Er} t E E}tE$7EEuuԋE$EEEEE;Er} t?E0E#EtE$ƣEEE}tʋE$E}uZ$E{ED$D$E$eE$:ED$E$X} t|D$E$=ECE#Et.D$E$ED$E$E}tD$E$֣}t'D$E$軣ED$E$詣ED$E$苣EE;Er߃}tD$E$dD$E$OED$ ED$D$E؉$UE}uU؋EE$_E$T}t E؉$E@[^]US$tAEEX=t$<[EE $wE}u$PEoE UT$$E}uT$E}u$E+U EUEBUEBUEP UE}t E$EEE$[]USÁ@}tE@ $E$[]US$J@>EE;Es EEtE;Es5EUEEEmE}tE;E sE;ErE$} 4[]US4蚹%.E EEEE܉D$ED$E$E}EEU E9s$BEE$?E}u蹋$9EU܋E)ЃEEED$ED$E$EUEU܋MEET$L$$bED$ED$E$wEE$E$E4[]US4Q,E EEEED$ED$E$E}EEEEE9EsUEuE v*UE9uE<uE9Es Ew$]ErEE+E$E}u%$ECE+MUEL$D$E$E+ED$ED$E$'EE$eE$ZE4[]US$Ì+EEED$E D$E$/'$[]US¶M+E EEEEEEЋD$D$Ẻ$Eԃ}hDžddEЋdD$ hD$D$ $H0Eԃ}&EЋ$*/EẺD$hD$E$Eԃ}ED$$+EdEE܋E܉$E؃}ub$EEEU؋EhEd9ErEdEU؋EEEE;ErۋEЋPE܃ 9s$BE!EЋ@+E܃EE$/E}u詇$)EE EEEE;ErEEEE$E}uT$EEEEUE‹EEEE;ErދEUEUEE‹EEEE;ErۋED$ED$E$EԋẺ$"E$7E$,E؉$!EԁĴ[]UWVSLóN(}Ѝ`EE UUЃ$;Et EE;Er؋E;Eu$EEE E}t }t]UUЃ UUЃ ED$ ED$ED$E$҉EcUUЃtHUUЃED$ ED$ED$E$҉E$-:EEL[^_]US$f&"t$<E2ED$ED$ED$ E D$D$E$FEE$[]US$Ê&~"t$<E2ED$ED$ED$ E D$D$E$EE$[]US4蘱#&"h$ED$E$EE$~E-ED$ED$ ED$D$E$]LD$E$@uED$E$$舮EEnED$ED$E$\ED$E$輬D$ED$ ED$D$E$KM UE)ЍEEE;Es"E;ErM UE)ЍEE;ErE$E$E$4[]US$ Ö$ t$<ExE$^6EEEE$E}u_$E0ED$ED$E$U EUEEEEE$[]US$^#$ݬED$E$Ǫ$軬ED$E$襪$虬EEdM UE)ЍD$ED$E$TED$ED$E$/D$ED$E$SEE;ErE$HE$=ED$E$JE$ $[]U(ED$E D$E$|E}uEEUEEU(EEEEED$E D$E$5E}uEEEEUEPEU7"EE;Et E}v}u EEEEUS$K!E $YE}u$SE1UED$ ED$E D$E$҉E}uU$E}t E$E$[]U(E$E}t$FfE;ED$D$ D$D$E$E}uUE EUSd[ t$<EEEEEEEE $LE}u$E}E@t$}E^EĉD$UD$ BD$BD$B D$ED$ED$E$2E}E؉D$E܉D$ D$D$E$UċEHED$ED$ T$D$ $E}$ƨEE؋U܉D$T$E$EԉD$ED$ ED$D$E$E}uYEԍUЉT$$E}u>UЍEȉD$ẺD$$wE}uEȋỦD$T$E $dEEԉ$EЉ$#E$Eĉ$聿Ẻ$vE܉$kEEEd[]USd ×t$<莿EEEEEEEEE $E}u$REE@t$}4EED$ED$E$E}$EEUD$T$E$ED$EĉD$$ټE}gEĉ$}E}t$FE?E؉$߽E}'UċM؋ED$ T$D$ $E}E؉D$ẺD$ ED$D$E$$E}U̍EЉD$EԉD$$(E}EȉD$UD$ BD$BD$B D$ED$ED$E$E}uWEЋUԉD$T$ D$D$E܉$UȋEHE D$E܉D$ T$D$ $EE؉$E$NẺ$CEĉ${Eȉ$衼Eԉ$薼E$苼EEEd[]USd,÷t$<讼EEEEEEEE@t$}E~E $E}u$[EVEЉD$UD$ BD$BD$B D$ED$ED$E$E} EԉD$E؉D$ D$D$E$UЋEHED$ED$ T$D$ $E}$EEԋU؉D$T$E$[E܉D$ ED$ED$E$6E}uYE܍UĉT$$E}u>UčEȉD$ẺD$$QE}uEȋỦD$T$E $>EE܉$謻Eĉ$E$EЉ$[Ẻ$PE؉$EEEEd[]USdqet$<hEEEEEEEEE@t$}5E E $E}u$ EEȉD$UD$ BD$BD$B D$ED$ED$E$E}ẺD$EЉD$ D$D$E؉$UȋEHE؉D$ED$ T$D$ $:E}7$1EE̋UЉD$T$E$ ED$ED$E $E}$EEUD$T$E$EEĉD$D$$޶E}Eĉ$wE}t$F蚾EsEԉ$E}u_UċMԋED$ T$D$ $E}u5E$bEEԉD$ ED$ED$E$EEԉ$ѸE$"E$Eĉ$svEȉ$uEЉ$jE$_EEEd[]USËt E<EE[]ÐUVS0ȡSEE4t2E D trE Du uTE LE 4E DD$L$ t$D$T$ EE}uE P}t D$D$$t0[^]US$ƠQEEE EEED$$v$[]US4膠EEE EE@ EE}tIE*EED$E$uuEEEEt}tE4[]US$ËTD$ED$$ EE$[]US$ßNTD$ED$$ EE$[]US4膟Et$<ET$-} tE E TEED$ED$ ED$D$T$ET$K.}uUEEPEE$UEE4[]UED$$U} tEE MEEUED$$ UE D$E$USAT$,E$ T$d-[]US$ÍE}tFD$D$E$tt!D$D$E$suEE$E}E@EE`EP ED$E$ru7} t E@‹E }tEP EEEEEP Et}tE$E$[]US$nE}u ET$g+TuǃTT$+T$2+D$ED$E$YE}u(E$GE}tE@EE$T$x+EEE$[]US$ ØET$*TuǃTT$+T$n*ETD$$E}tE@EE$T$*E$[]US$fE$E@$UD$D$$ofEPE$ҋE@E}uE@t%E@‹E@T$D$E$J$[]US$3þ}E@ t E$ E@EiE܋@ET$ E܋@$fT$!E܉EE܋@ EEEm}uE܉$EE܃}uE@t>E@EE@EEEm}uE@$芦EEE@EEEm}uE$X$[]UE$UVS yE@ E@tQEP E@M T$ D$D$ $Ift D$D$$}tKE@ D$ D$ED$E $et D$D$$ǓE@E[E@t'EpE@U MD$T$ $֋EHUED$E D$$ыE@E}uE@ [^]UED$E D$E$US4耏 E@lE@tD$D$E$JE@EEPE$ҋE@E}uދE@E@E$EED$E$EE$,EE@D$ D$ED$E$E}tED$$AE@EPE@UL$D$$\UED$ED$$CE$UED$$=‹ED$T$E$bE$4[]US4wE$EE}u EE@;EE$$E}u4`$`E<ED$ E D$ED$E$EE E$EE@;Es*D$ D$cD$Ŀ$E@‹E@T$D$$`E@EEPE@EED$E D$E$uaED$E D$E$\aE.EUEE46EUEE4\EE@;EŋE$芡EE؃4[]US$*õEE E}t}}tb} t;}!tITE$^NED$ED$E$b$>E(ED$E$E$xE=E$ $[]UE$UE]U(EE@u EF-U ED$T$E$:E}u E$0E$U} tE D$E$  E$US$؊cE@E} u6}tE@t$贏EP E$҉EdE@E1E@PE 9uEP E$҉E/E@E}uɍD$D$$E$[]UD$ D$D$E$E D$E$USՉ`$D$D$ D$D$$?[]UVS 腉}uED$ED$E $ }u'uED$ED$E $虠}u%tK$tD$ D$ED$E$TE}t,E$K$ ^D$ED$D$膍UED$ED$$E$E$ƋUED$$t$D$E $]E$ [^]US48E@E}tJE@t@tD$D$ hD$D$$J$R}tE@@EEE4[]UE$^US$蔇ET$*TuǃTT$T$ETD$$3E}tE@@EE$T$QE$[]UE$GUS$نdET$oTuǃTT$T$:ETD$$xE}tY} tE@@‹E }tE@@‹EE@@EE$T$jEEED$$׊E$[]US$sEE E}t } t0}u}t E-E$oEE$\E}D$ED$E$E}t/EE9r#ED$ED$E$ZUE5}u}t UE}t EBE-E=E$m$[]UVS`܄g[E@ t${TTTE D$T$ D$D$1EƉ$[E0 D$EƉ$MYF E@ uEƉD$$C`[^]UWVSLèE@ tAE@tD$D$E$E@ $mXE@ EEE*EEƿEUEUċMϋU։UM̋EEUMMEUE؉U܃L[^_]UEE E} t}#tzE@‹Ep}t}tEt E-QEEEE@E$E@PE9u EE@E}uE=E$:US讂9ET$DTuǃTT$E[]U(ED$ D$D$ E$tEEU(EED$ E D$D$#E$tEEUS$lET$wTE D$ED$$|ET$E$[]US4脁EEET$ TuwǃTT$T$ETD$$E}tE@u E@ E􍃬T$4}t)Et EED$E D$E$҉EqE}td}t E@t"}t (E ;EEE OEED$ eD$ED$l$EЃ}t'T$E$T$gE$A4[]ÐUS$ÄE$;E ttED$ED$E$tEUED$ED$$#tE$sEUED$E D$$UED$$*E}uE$&EEE D$ED$E$GRtE$EE$EE$[]US~WEEEUlE}?~D$D$D$@lD$ D$ D$$VE}}EEE0EUlEE}~D$D$D$lD$ D$ &D$$E}0EEEPEUlEE}c~D$?D$D$dlD$ D$ TD$$FE}^EEEpEUlEE}0~D$mD$D$1lD$ D$ D$$E}u Džh4} t$ED$ ED$D$$E Džh2hĴ[]UWVSLE܋E`)ЋDD$0t$|$U؉T$ U܉T$D$$ E}u3}t$EE`)ЋE1} t$ED$ ED$D$ $E E2E<[^_]UWVSD$$.E}u E$Gp9hVUE쉃hVUEBE$‹EPUE B $[]US$*rõhVE}E@tkE@;Eu`E@ ;E uUE@EE@E$Y;Et*D$ D$D$$uEEEE}yEE$[]UwETE T]USTqTt2TTD$D$ ED$D$ $҃[]U(U ED$ED$ T$D$E$E$ oEU(U ED$ED$ T$D$E$E$ -EUVSxpEEEEEEEEEEEEEEE$EEEEE}/w E-8} FE E}uUEEEEEEEUE)Ѓu;Esm$glEЃ}t }t}w E- }t;mE̍E)ЃuEŰE)щʋEE)ȉE'ŰE)ЃuEEUE)ЉE$‰t1ED$ED$ED$ ẺD$ED$$sE$;lEċE UD$D$ D$T$E$V E}t,E UD$D$ D$T$Ẻ$$ EED$$ɃE}u@$eAE E$E}u@$6AE EEEEE;ErUЃE}tE}wED$E$E}u@$@E EEEEE;Er}E(EE$bEEEE;ErЋED$$聂E}uw?$@E| T$at E?^ EEEEEE}tUEuED$E$EEu%T$t E?EEEu8EuED$D$ D$D$E$ EUEEUEEEE;E }tT$t E?0EEUMD$T$ $WT$t E?EEEEEEEEu[}tUEuED$E$EEu%T$t E?_EEEu8EuED$D$ D$D$E$9 EUEEUEEEEE;Es E;E}tT$Gt E?EE;Eu#E$E$!Z\ED$Eĉ$dD$EĉD$Eĉ$}tED$EĉD$Eĉ$E&EED$EĉD$Eĉ$EE;ErD$EĉD$Eĉ$Eĉ$EȋE;Es]E}vZEE$>E$^E UD$D$ D$T$E$EMEE;Ev]E}vZEm$<E$T^E UD$D$ D$T$E$'EEE;EE0D$E,D$ D$EЉD$Eĉ$k $Ђ#$ wEĉD$G$/ED$S$/}tED$_$/E"EED$k$d/EE;Er֋E$ƋEĉ$t$D$w$Bl}tE$D$$lE1EE$oD$ED$$kEE;Er$ `}wED$$C|E}u99$9E>}(EEuD$$aEEuE$_^E}tEuE$<^EE*EuEE$ ^EEE;ErE}tuEuE$]E&EuEE$]EE;Ev.EuEE$z]EE;Er҃}Eċ@$WEEċ@$WEEċ@$WE}t EEEUEUE4$aD$EĉD$E$D$E$2`D$ED$E$-$St)$miE$}+$|i $^E]EED$ED$E$EĉD$ ED$ED$E$D$E$tEE;Ew$~t $ HE;EUE$hYE$]YE$RYE$GY$7~u $ }T$EEyEEteEEE;Et EE;ErE;Eu#}tEEED$$fEE$XEE;E{}tT$tE?EE$wE$w}t E$w}t E$wwEЉ$XE$XE$W}uU Eĉ}tWUEM}t$W $^E]EED$ED$E$E D$ ED$ED$E$D$E$Kt EE;E|$alt $ E;EE$%OE$OE$OUEEE؃D[]USQæ}tE$=E$=E$=`$=Ẻ$AUEЉ$=EȉTT[^]US?UEEE$賸;Et@D$ED$E$跦E}tiE t tnEUT$UT$$~\D$D$a$E!UD$D$$8E}~ }E}u;UED$$藴EED$ED$E$t EE$sE쉅[]U EEE@EEEEeEEEeEEȋEU‹EEEU‰ȈEEEЋEE%E0‹E E Em}iEUEUPUS$=EEED$ ED$E D$E$$@hC$[]US$A=̱EETu7ǃTTTtTD$$oATtDž28}wDž,#E@EPEEME‹ETE}~E!MEuE  E}~EEEvUEDUE‰1)1‰)ȉEUEDEMUETETME‹ETE}~D$D$$Dž$[]US$;EEED$E D$E$E$,fAE$[]US4<;ǯD$D$$D$ D$D$$RD$D$$tD$D$$D$ D$D$$D$D$$ t Dž4[]ÐU E EEEEEEEEEEEE EEE1ЉEEEEEEE1EE‹E1ЉEEE1ЉEEEEEEE1EE‹E1ЉEEE1ЉEEEEEEE1EE‹E1ЉEE E1ЉEEEEEEE1EE‹E1ЉEEE1ЉEEEEEEE1EE‹E1ЉEEE1ЉEEEEEEE1EE‹E1ЉEEE1ЉEEEEEEE1EE‹E1ЉEEE1ЉEEEEEEE1EE‹E1ЉEE E1ЉEEEEEEE1EE‹E1ЉEE$E1ЉEEEEEEE1EE‹E1ЉEE(E1ЉEEEEEEE1EE‹E1ЉEE,E1ЉEEEEEEE1EE‹E1ЉEE0E1ЉEEEEEEE1EE‹E1ЉEE4E1ЉEEEEEEE1EE‹E1ЉEE8E1ЉEEEEEEE1EE‹E1ЉEE<E1ЉEEEEEEE1EE‹E1ЉEE@E1ЉEEDE1ЉEUE UEU E EEEEEEEEEEEE EEDE1ЉEEEEEEE1EE‹E1ЉEE@E1ЉEEEEEEE1EE‹E1ЉEE<E1ЉEEEEEEE1EE‹E1ЉEE8E1ЉEEEEEEE1EE‹E1ЉEE4E1ЉEEEEEEE1EE‹E1ЉEE0E1ЉEEEEEEE1EE‹E1ЉEE,E1ЉEEEEEEE1EE‹E1ЉEE(E1ЉEEEEEEE1EE‹E1ЉEE$E1ЉEEEEEEE1EE‹E1ЉEE E1ЉEEEEEEE1EE‹E1ЉEEE1ЉEEEEEEE1EE‹E1ЉEEE1ЉEEEEEEE1EE‹E1ЉEEE1ЉEEEEEEE1EE‹E1ЉEEE1ЉEEEEEEE1EE‹E1ЉEE E1ЉEEEEEEE1EE‹E1ЉEEE1ЉEEEEEEE1EE‹E1ЉEEE1ЉEEE1ЉEUE UEUEE ‹E ‹E ЉEEE ‹E ‹E ЉEED$ED$E$E‹E U EU EU EU EU EU EU EUS$8*ÞEEED$E D$E$$@0$[]UEE ‹E ‹E ЉEEE ‹E ‹E ЉEED$ED$E$E‹E U EU EU EU EU EU EU EUS$(qEEED$E D$E$$@.$[]US(+ ƅƅƅƅƅvƅTƅ2ƅƅAƅyƅnƅƅRƅaƅnƅƅƅƅƅƅ,ƅƅƅChD$D$$D$D$$GD$D$$tx)D$D$$BD$D$$KtxD$D$$D$D$$yD$D$$tx^D$D$$wD$D$$tx DžxxĔ[]US4&ÝTu7ǃTDTTtTD$ $F*Tt E2EME􋔃 EE}~E\ME􋔃 EME􋔃 EME􋔃 EME􋔃 E E}~EEEEPEE EHEuE EHEuE MEuE MUEE1‹EEuЉEE}XEEEE@ED$ED$E$MUEMUEE}~E8ED$ED$E$MUEMUEE}~E@ED$ED$E$zMUEMUEE}~E@ED$ED$E$(MUEMUEE}~E@ED$ED$E$MUE MUE E}~EEE}UE UE9tZUEUE9t+UEEM!?+UEEM@UEEMAUEEM@UEEMAUEEE} $[]US$2Z&VuATu7ǃT&TTtTD$`$Tt E2-ED$E $fE耉D$E$LED$E$5$ EM^+UEEM_+UEEM >+UEEM!?+UEEM@+UEEMA+UEEE}5EE$[]UWX}t EEEEEEE E  ‹E  ‹E  ЉEE E  ‹E  ‹E  ЉEE3E%EE1EE1EE3E%EE1EE1EE3E%3333EE1EE1EE3E%EE1EE1EME3E%EE1EE1EME3EEEE?`1EE?`1EE?`1EE?`1EEE1ЉEEE?`1EE?`1EE?`1EE?`1EE3EEEE?`1EE?`1EE?`1EE?`1EEE1ЉEEE?`1EE?`1EE?`1EE?`1EE3EEEE?`1EE?`1EE?`1EE?`1EEE1ЉEEE?`1EE?`1EE?`1EE?`1EE3EEEE?`1EE?`1EE?`1EE?`1EEE1ЉEEE?`1EE?`1EE?`1EE?`1EE3EEEE?`1EE?`1EE?`1EE?`1EEE1ЉEEE?`1EE?`1EE?`1EE?`1EE3EEEE?`1EE?`1EE?`1EE?`1EEE1ЉEEE?`1EE?`1EE?`1EE?`1EE3EEEE?`1EE?`1EE?`1EE?`1EEE1ЉEEE?`1EE?`1EE?`1EE?`1EE3EEEE?`1EE?`1EE?`1EE?`1EEE1ЉEEE?`1EE?`1EE?`1EE?`1EE3EEEE?`1EE?`1EE?`1EE?`1EEE1ЉEEE?`1EE?`1EE?`1EE?`1EE3EEEE?`1EE?`1EE?`1EE?`1EEE1ЉEEE?`1EE?`1EE?`1EE?`1EE3EEEE?`1EE?`1EE?`1EE?`1EEE1ЉEEE?`1EE?`1EE?`1EE?`1EE3EEEE?`1EE?`1EE?`1EE?`1EEE1ЉEEE?`1EE?`1EE?`1EE?`1EE3EEEE?`1EE?`1EE?`1EE?`1EEE1ЉEEE?`1EE?`1EE?`1EE?`1EE3EEEE?`1EE?`1EE?`1EE?`1EEE1ЉEEE?`1EE?`1EE?`1EE?`1EE3EEEE?`1EE?`1EE?`1EE?`1EEE1ЉEEE?`1EE?`1EE?`1EE?`1EE3EEEE?`1EE?`1EE?`1EE?`1EEE1ЉEEE?`1EE?`1EE?`1EE?`1EE3EEEE?`1EE?`1EE?`1EE?`1EEE1ЉEEE?`1EE?`1EE?`1EE?`1EE3EEEE?`1EE?`1EE?`1EE?`1EEE1ЉEEE?`1EE?`1EE?`1EE?`1EE3EEEE?`1EE?`1EE?`1EE?`1EEE1ЉEEE?`1EE?`1EE?`1EE?`1EE3EEEE?`1EE?`1EE?`1EE?`1EEE1ЉEEE?`1EE?`1EE?`1EE?`1EE3EEEE?`1EE?`1EE?`1EE?`1EEE1ЉEEE?`1EE?`1EE?`1EE?`1EE3EEEE?`1EE?`1EE?`1EE?`1EEE1ЉEEE?`1EE?`1EE?`1EE?`1EE3EEEE?`1EE?`1EE?`1EE?`1EEE1ЉEEE?`1EE?`1EE?`1EE?`1EE3EEEE?`1EE?`1EE?`1EE?`1EEE1ЉEEE?`1EE?`1EE?`1EE?`1EE3EEEE?`1EE?`1EE?`1EE?`1EEE1ЉEEE?`1EE?`1EE?`1EE?`1EE3EEEE?`1EE?`1EE?`1EE?`1EEE1ЉEEE?`1EE?`1EE?`1EE?`1EE3EEEE?`1EE?`1EE?`1EE?`1EEE1ЉEEE?`1EE?`1EE?`1EE?`1EE3EEEE?`1EE?`1EE?`1EE?`1EEE1ЉEEE?`1EE?`1EE?`1EE?`1EE3EEEE?`1EE?`1EE?`1EE?`1EEE1ЉEEE?`1EE?`1EE?`1EE?`1EE3EEEE?`1EE?`1EE?`1EE?`1EEE1ЉEEE?`1EE?`1EE?`1EE?`1EE3EEEE?`1EE?`1EE?`1EE?`1EEE1ЉEEE?`1EE?`1EE?`1EE?`1EE3EEEE?`1EE?`1EE?`1EE?`1EEE1ЉEEE?`1EE?`1EE?`1EE?`1EE3EEEE?`1EE?`1EE?`1EE?`1EEE1ЉEEE?`1EE?`1EE?`1EE?`1EE3EEEE?`1EE?`1EE?`1EE?`1EEE1ЉEEE?`1EE?`1EE?`1EE?`1EE3EEEE?`1EE?`1EE?`1EE?`1EEE1ЉEEE?`1EE?`1EE?`1EE?`1EE3EEEE?`1EE?`1EE?`1EE?`1EEE1ЉEEE?`1EE?`1EE?`1EE?`1EE3EEEE?`1EE?`1EE?`1EE?`1EEE1ЉEEE?`1EE?`1EE?`1EE?`1EE3EEEE?`1EE?`1EE?`1EE?`1EEE1ЉEEE?`1EE?`1EE?`1EE?`1EE3EEEE?`1EE?`1EE?`1EE?`1EEE1ЉEEE?`1EE?`1EE?`1EE?`1EE3EEEE?`1EE?`1EE?`1EE?`1EEE1ЉEEE?`1EE?`1EE?`1EE?`1EE3EEEE?`1EE?`1EE?`1EE?`1EEE1ЉEEE?`1EE?`1EE?`1EE?`1EE3EEEE?`1EE?`1EE?`1EE?`1EEE1ЉEEE?`1EE?`1EE?`1EE?`1EE3EEEE?`1EE?`1EE?`1EE?`1EEE1ЉEEE?`1EE?`1EE?`1EE?`1EE3EEEE?`1EE?`1EE?`1EE?`1EEE1ЉEEE?`1EE?`1EE?`1EE?`1EE3EEEE?`1EE?`1EE?`1EE?`1EEE1ЉEEE?`1EE?`1EE?`1EE?`1EE3EEEE?`1EE?`1EE?`1EE?`1EEE1ЉEEE?`1EE?`1EE?`1EE?`1EE3EEEE?`1EE?`1EE?`1EE?`1EEE1ЉEEE?`1EE?`1EE?`1EE?`1EE3EEEE?`1EE?`1EE?`1EE?`1EEE1ЉEEE?`1EE?`1EE?`1EE?`1EME3E%EE1EE1EME3E%EE1EE1EE3E%3333EE1EE1EE3E%EE1EE1EE3E%EE1EE1EE‹EUEUEUEUEUEUEUEUS4F3EMEE ЈD E}~EE?hEU‰EED$D$E$E}u E)}~ EE EEE;E~EE؃4[]UWVSu3EUEUEUEUEUEUEUEUEEEEEEEEE$EnEʝE˹EEPE8EEE؉D$$!D$ ED$EЉD$$D$ ED$ED$$ED$$D$ ED$ED$$D$ED$E؉$D$ED$EЉ$E}?(D$EȉD$E$Htp&EEEEEvETE2EEE4EVExEEEEEE"E3EDEEEEE{E8E;E#EE}E&EEED$ED$$KD$ ED$ED$$%D$ ED$ED$$ED$ ED$ED$$6D$ ED$ED$$E}GD$ED$E$Ԏt-pD$T$ $.EqU荍xU荍HU荵|$ L$D$|$CU荍PD$ ED$T$|$U荍 D$ED$$辍tHpU荍 D$ ED$T$|$,U荍PD$ED$$:txpEE D$D$E$ tpE,EUD$D$$)E}?~΋ED$$B/ED$D$E$wEE$$(}tpHE/E$upE}?~DžppĜ[^_]US$蹸D-EE}t E,E U D$ T$E D$E$EuHE $ u$E $uE $t$@;E+$@&EE$[]UEEEE tEǀE=EUS$K,EED$ E D$ED$E$$ 虽$[]US$u,EED$ E D$ED$E$=$ N$[]US$*õ+EE}t E,IE D$E$0E $t$@E+$@߼EE$[]US$豶<+EED$ E D$ED$E$$ 芼$[]US$f*EED$ E D$ED$E$Y$ ?$[]US$æ*EE}u E1} t$ED$ ED$D$$E E2E$[]UEtED$E $rEE EÐUVSpx*E%uATu7ǃT TTtTD$/$蜹Tt E2E@E@}uBE E t`E@UED$E D$$x8}uE E"} uEE E,UE܉E@E.EMEE 0Uȃ<EE;ErʋEE!UEMEm}yEEEVE E‹EMEEEE;E}}~}u EEE;EE܃;EUED`0ЈEUED`0ЈEUED`0ЈEUED`0ЈEUE`/0ЈEE}tLE6UE UE0EPE1EE;E|E6UE UE0EPE1EU;EULUD`0ȈDULUD`0ȈDULUD`0ȈDULUD`0ȈDUE6UE UE0EPE1EE;E|EVE E‹EMEEEE;E}}~}u EEE;E} E܃;E΋E܃;EEEp[^]US$b$EEED$E D$E$E$@E$[]UVSã$EUEU EUEHU EUEHU EUEH U E E}JEYUEEEE`0E`#1ƋE`'1ƋE`+1UEEEE`0E`#1ƋE`'1ƋE`+1UEEEE`0E`#1ƋE`'1ƋE`+1UE EEE`0E`#1ƋE`'1ƋE`+1EE;E[^]UVS ɬT!EEMEE 1ЉEHEE 1ЉEHEE 1ЉEH E E 1ЉM E`0E`1E`1E` 1E E`0E`1E`1E` 1E E`0E`1E`1E` 1E E`0E`1E`1E` 1ENuE U E1ȉEpE U E1ȉEpE U E1ȉEp E U E 1ȉM E`0E`1E`1E` 1E E`0E`1E`1E` 1E E`0E`1E`1E` 1E E`0E`1E`1E` 1EE;EuE E PE1ȉEpE E PE1ȉEpE E PE1ȉEp E E PE 1ȉEaE U EaU EaU EaU EaU EaU EaU EaU EaU EaU EaU EaU EaU EaU EaU Eau E U E1ȉE ƋE U E1ȉE ƋE U E1ȉE ƋE U E 1ȉ [^]US4|D$ED$E$#zED$E܉D$E$mD$E܉D$E $y4[]UWVSLàEEEEE} t EED$ED$E؉$yEu؍}ȍUȓD$EȉD$E$WyL[^_]US$|EEE@t/ED$ E D$D$E$"$?K%ED$E D$E$$8$$[]US4ËEEEEEEE@bE D$ E D$D$E$E EE(U E0ȈEEEEE}~҃m}u`E D$E D$E$E EE(U E0ȈEEEEE}~҃m}u$84[]US4{EEEEEEE EE#EMEEE0ЈEE}~׋E@t#ED$ ED$D$E$MED$ED$E$D$ED$E $wE}uEm}L$8%4[]UVS ËEEuEUE1ȉEpEUE1ȉEpEUE1ȉEp E UE 1ȉM E`0E`1E`1E`1E E`0E`1E`1E`1E E`0E`1E`1E`1E E`0E`1E`1E`1EEZuE UE1ȉEpE UE1ȉEpE UE1ȉEp E UE 1ȉM E`0E`1E`1E`1E E`0E`1E`1E`1E E`0E`1E`1E`1E E`0E`1E`1E`1m}ME E1ЉEHE E1ЉEHE E1ЉEH E E1ЉE`E U E`U E`U E`U E`U E`U E`U E`U E`U E`U E`U E`U E`U E`U E`U E`M E E1ЉE E E1ЉE E E1ЉE E E 1Љ [^]US4軚FE@u!E${$@覠E@D$ED$E$7oED$E܉D$E$JD$E܉D$E $o4[]US$+öEEE@t/ED$ E D$D$E$$8%ED$E D$E$$8ӟ$[]US4诙:EEEEEEE@lE D$ E D$D$E$CE EE2EEEE2UEEUEEE}~ȃm}ujE D$E D$E$$E EE2EEEE2UEEUEEE}~ȃm}u$8诞4[]USD苘 EEEEEED$ED$E؉$mE@t#ED$ ED$D$E$ED$ED$E$GE EE#EMEEE0ЈEE}~D$E؉D$E $lEEm}8$X謝D[]US4腗 D$/D$$/D$D$$D$/D$$Tjt 0^D$D$$D$/D$$jt,0 Dž4[]US4菖 D$D$$D$D$$D$L0D$$^it\0^D$D$$D$D$$ it|0 Dž4[]US4處$ D$ D$$ D$D$$D$0D$$hht0^D$D$$D$ D$$ht0 Dž4[]UE}uE}uE}tEEEEEUVS_ 1HD$T$ $hDžDžE)UU-T;Et EEvσ}u-$6$6h2UU-TD$ D$D$$3E}t-$76$)625UU-TD$ D$D$$2E}t-$5$52UD$D$$QE}u=UD$D$$QE}t-$ 5$42 UD$D$$AQE}u@UD$D$$PE}t-$S4$E42QEUE􍵤D$D$ D$D$$aKE}t-$3$32UE􍵤0D$D$$ct-$>3$032<UE􍵤0D$D$ D$D$$ME}t-$2$22UE􍵤D$D$$bt*$52$'226EE$1$1DžĐ[^]US$y2EFE}uK}t<2E$GE}u'2E$)E}u E1} t$ED$ ED$D$2$E E2E$[]US$@2EE}u E1} t$ED$ ED$D$2$E E2E$[]US$ԍ_2EE}u E1} t$ED$ ED$D$ 2$E E2E$[]U(EE}t%} t6}tEED$E $HE5ED$E $EED$E $4EE EÐUSDÀEEEEEEEEEEEEEEEEEt E,kTu7ǃTTTtTD$LI$ϐTt E2hkE t\E `FEE`G0EE-`G0EE`G0EE-`G0EE tfE `FEE-`G0EE`G0EED`G0EE`G0EE tjE `FEE`G0EE`G0EE`G0EE`G0EE tfE `FEE`G0EE`G0EE=`G0EE`G0EE tfE `FEE`G0EEF`G0EEf`G0EE`G0EE tfE `FEE`G0EE<`G0EE[`G0EE`G0EE tfE `FEE`G0EE7`G0EEO`G0EE`G0EE thE `FEE`G0EE`G0EE`G0EE`G0EE t_E `FEE`G0EE-`G0EE`G0EE-`G0EE tfE `FEE-`G0EE`G0EED`G0EE`G0EE tjE `FEE`G0EE`G0EE`G0EE`G0EE tfE `FEE`G0EE`G0EE=`G0EE`G0EE tfE `FEE`G0EEF`G0EEf`G0EE`G0EE tfE `FEE`G0EE<`G0EE[`G0EE`G0EE tfE `FEE`G0EE7`G0EEO`G0EE`G0EE thE `FEE`G0EE`G0EE`G0EE`G0E} CE t_E `FEE`G0EE-`G0EE`G0EE-`G0EE tfE `FEE-`G0EE`G0EED`G0EE`G0EE tjE `FEE`G0EE`G0EE`G0EE`G0EE tfE `FEE`G0EE`G0EE=`G0EE`G0EE tfE `FEE`G0EEF`G0EEf`G0EE`G0EE tfE `FEE`G0EE<`G0EE[`G0EE`G0EE tfE `FEE`G0EE7`G0EEO`G0EE`G0EE thE `FEE`G0EE`G0EE`G0EE`G0EE t_E `FEE`G0EE-`G0EE`G0EE-`G0EE tfE `FEE-`G0EE`G0EED`G0EE`G0EE tjE `FEE`G0EE`G0EE`G0EE`G0EE tfE `FEE`G0EE`G0EE=`G0EE`G0EE tfE `FEE`G0EEF`G0EEf`G0EE`G0EE tfE `FEE`G0EE<`G0EE[`G0EE`G0EE tfE `FEE`G0EE7`G0EEO`G0EE`G0EE thE `FEE`G0EE`G0EE`G0EE`G0EEE؉EEDMԋE2E`52E`42E`42E`6EMԋE2E`52E`52E`42E`:EMԋE2E`42E`42E`52E`>EMԋE2E`42E`52E`52E`BE EEE}E 4u`5E 0`4E 0`4E 0`6E 4`5E 0`5E 0`4E 0`:1E 4`4E 0`4E 0`5E 0`>1E 4u`4E 0`5E 0`5E 0`B1ȉEE 4`5E 0`4E 0`4E 0`6E 4g`5E 0`5E 0`4E 0`:1E 4g`4E 0`4E 0`5E 0`>1E 4`4E 0`5E 0`5E 0`B1ȉEMEEEEUEEEE 4`5E 0`4E 0`4E 0`6E 4`5E 0`5E 0`4E 0`:1E 4`4E 0`4E 0`5E 0`>1E 4`4E 0`5E 0`5E 0`B1ȉEE 4`5E 0`4E 0`4E 0`6E 4`5E 0`5E 0`4E 0`:1E 4`4E 0`4E 0`5E 0`>1E 4`4E 0`5E 0`5E 0`B1ȉEMEEEEUEEE E 4`5E 0`4E 0`4E 0`6E 4`5E 0`5E 0`4E 0`:1E 4`4E 0`4E 0`5E 0`>1E 4`4E 0`5E 0`5E 0`B1ȉEE 4{`5E 0`4E 0`4E 0`6E 4`5E 0`5E 0`4E 0`:1E 4`4E 0`4E 0`5E 0`>1E 4{`4E 0`5E 0`5E 0`B1ȉEMEEEEUEEEE 4`5E 0`4E 0`4E 0`6E 4`5E 0`5E 0`4E 0`:1E 4`4E 0`4E 0`5E 0`>1E 4`4E 0`5E 0`5E 0`B1ȉEE 4`5E 0`4E 0`4E 0`6E 4v`5E 0`5E 0`4E 0`:1E 4v`4E 0`4E 0`5E 0`>1E 4`4E 0`5E 0`5E 0`B1ȉEMEEEEUEEEE 4J`5E 0`4E 0`4E 0`6E 4`5E 0`5E 0`4E 0`:1E 4`4E 0`4E 0`5E 0`>1E 4J`4E 0`5E 0`5E 0`B1ȉEE 4`5E 0`4E 0`4E 0`6E 4`5E 0`5E 0`4E 0`:1E 4`4E 0`4E 0`5E 0`>1E 4`4E 0`5E 0`5E 0`B1ȉEMEEEEUE EE$E 4`5E 0`4E 0`4E 0`6E 4`5E 0`5E 0`4E 0`:1E 4`4E 0`4E 0`5E 0`>1E 4`4E 0`5E 0`5E 0`B1ȉEE 4k`5E 0`4E 0`4E 0`6E 4x`5E 0`5E 0`4E 0`:1E 4x`4E 0`4E 0`5E 0`>1E 4k`4E 0`5E 0`5E 0`B1ȉEMEEEEUE(EE,E 4E`5E 0`4E 0`4E 0`6E 4`5E 0`5E 0`4E 0`:1E 4`4E 0`4E 0`5E 0`>1E 4E`4E 0`5E 0`5E 0`B1ȉEE 4}`5E 0`4E 0`4E 0`6E 4`5E 0`5E 0`4E 0`:1E 4`4E 0`4E 0`5E 0`>1E 4}`4E 0`5E 0`5E 0`B1ȉEMEEEEUE0EE4E 4`5E 0`4E 0`4E 0`6E 4`5E 0`5E 0`4E 0`:1E 4`4E 0`4E 0`5E 0`>1E 4`4E 0`5E 0`5E 0`B1ȉEE 4K`5E 0`4E 0`4E 0`6E 48`5E 0`5E 0`4E 0`:1E 48`4E 0`4E 0`5E 0`>1E 4K`4E 0`5E 0`5E 0`B1ȉEMEEEEUE8EE<E 4`5E 0`4E 0`4E 0`6E 4 `5E 0`5E 0`4E 0`:1E 4 `4E 0`4E 0`5E 0`>1E 4`4E 0`5E 0`5E 0`B1ȉEE 42`5E 0`4E 0`4E 0`6E 4`5E 0`5E 0`4E 0`:1E 4`4E 0`4E 0`5E 0`>1E 42`4E 0`5E 0`5E 0`B1ȉEMEEEEUE@EEDE 4`5E 0`4E 0`4E 0`6E 45`5E 0`5E 0`4E 0`:1E 45`4E 0`4E 0`5E 0`>1E 4`4E 0`5E 0`5E 0`B1ȉEE 4`5E 0`4E 0`4E 0`6E 4`5E 0`5E 0`4E 0`:1E 4`4E 0`4E 0`5E 0`>1E 4`4E 0`5E 0`5E 0`B1ȉEMEEEEUEHEELE 47`5E 0`4E 0`4E 0`6E 4`5E 0`5E 0`4E 0`:1E 4`4E 0`4E 0`5E 0`>1E 47`4E 0`5E 0`5E 0`B1ȉEE 4q`5E 0`4E 0`4E 0`6E 4`5E 0`5E 0`4E 0`:1E 4`4E 0`4E 0`5E 0`>1E 4q`4E 0`5E 0`5E 0`B1ȉEMEEEEUEPEETE 4`5E 0`4E 0`4E 0`6E 4`5E 0`5E 0`4E 0`:1E 4`4E 0`4E 0`5E 0`>1E 4`4E 0`5E 0`5E 0`B1ȉEE 4`5E 0`4E 0`4E 0`6E 4l`5E 0`5E 0`4E 0`:1E 4l`4E 0`4E 0`5E 0`>1E 4`4E 0`5E 0`5E 0`B1ȉEMEEEEUEXEE\E 40`5E 0`4E 0`4E 0`6E 4C`5E 0`5E 0`4E 0`:1E 4C`4E 0`4E 0`5E 0`>1E 40`4E 0`5E 0`5E 0`B1ȉEE 4`5E 0`4E 0`4E 0`6E 4u`5E 0`5E 0`4E 0`:1E 4u`4E 0`4E 0`5E 0`>1E 4`4E 0`5E 0`5E 0`B1ȉEMEEEEUE`EEdE 4`5E 0`4E 0`4E 0`6E 47`5E 0`5E 0`4E 0`:1E 47`4E 0`4E 0`5E 0`>1E 4`4E 0`5E 0`5E 0`B1ȉEE 4`5E 0`4E 0`4E 0`6E 4&`5E 0`5E 0`4E 0`:1E 4&`4E 0`4E 0`5E 0`>1E 4`4E 0`5E 0`5E 0`B1ȉEMEEEEUEhEElE 4`5E 0`4E 0`4E 0`6E 4`5E 0`5E 0`4E 0`:1E 4`4E 0`4E 0`5E 0`>1E 4`4E 0`5E 0`5E 0`B1ȉEE 4`5E 0`4E 0`4E 0`6E 4`5E 0`5E 0`4E 0`:1E 4`4E 0`4E 0`5E 0`>1E 4`4E 0`5E 0`5E 0`B1ȉEMEEEEUEpEEtE 4`5E 0`4E 0`4E 0`6E 4`5E 0`5E 0`4E 0`:1E 4`4E 0`4E 0`5E 0`>1E 4`4E 0`5E 0`5E 0`B1ȉEE 4?`5E 0`4E 0`4E 0`6E 4H`5E 0`5E 0`4E 0`:1E 4H`4E 0`4E 0`5E 0`>1E 4?`4E 0`5E 0`5E 0`B1ȉEMEEEEUExEE|E 4^`5E 0`4E 0`4E 0`6E 4`5E 0`5E 0`4E 0`:1E 4`4E 0`4E 0`5E 0`>1E 4^`4E 0`5E 0`5E 0`B1ȉEE 4`5E 0`4E 0`4E 0`6E 4`5E 0`5E 0`4E 0`:1E 4`4E 0`4E 0`5E 0`>1E 4`4E 0`5E 0`5E 0`B1ȉEMEEEEUEEEE 4`5E 0`4E 0`4E 0`6E 4`5E 0`5E 0`4E 0`:1E 4`4E 0`4E 0`5E 0`>1E 4`4E 0`5E 0`5E 0`B1ȉEE 4[`5E 0`4E 0`4E 0`6E 40`5E 0`5E 0`4E 0`:1E 40`4E 0`4E 0`5E 0`>1E 4[`4E 0`5E 0`5E 0`B1ȉEMEEEEUEEEE 4`5E 0`4E 0`4E 0`6E 4`5E 0`5E 0`4E 0`:1E 4`4E 0`4E 0`5E 0`>1E 4`4E 0`5E 0`5E 0`B1ȉEE `5E 0`4E 0`4E 0`6E 4T`5E 0`5E 0`4E 0`:1E 4T`4E 0`4E 0`5E 0`>1E `4E 0`5E 0`5E 0`B1ȉEMEEEEUEEEE 4`5E 0`4E 0`4E 0`6E 4`5E 0`5E 0`4E 0`:1E 4`4E 0`4E 0`5E 0`>1E 4`4E 0`5E 0`5E 0`B1ȉEE 4`5E 0`4E 0`4E 0`6E 4#`5E 0`5E 0`4E 0`:1E 4#`4E 0`4E 0`5E 0`>1E 4`4E 0`5E 0`5E 0`B1ȉEMEEEEUEEE EE؉EEMԋE2E`42E`6EMԋE2E`42E`:EMԋE2E`52E`>EMԋE2E`52E`BE EEE}E 4`4E 0`6E 4u`4E 0`:1E 4`5E 0`>1E 4u`5E 0`B1ȉEE 4g`4E 0`6E 4`4E 0`:1E 4g`5E 0`>1E 4`5E 0`B1ȉEMEEEEUEEEE 4`4E 0`6E 4`4E 0`:1E 4`5E 0`>1E 4`5E 0`B1ȉEE 4`4E 0`6E 4`4E 0`:1E 4`5E 0`>1E 4`5E 0`B1ȉEMEEEEUEEE E 4`4E 0`6E 4`4E 0`:1E 4`5E 0`>1E 4`5E 0`B1ȉEE 4`4E 0`6E 4{`4E 0`:1E 4`5E 0`>1E 4{`5E 0`B1ȉEMEEEEUEEEE 4`4E 0`6E 4`4E 0`:1E 4`5E 0`>1E 4`5E 0`B1ȉEE 4v`4E 0`6E 4`4E 0`:1E 4v`5E 0`>1E 4`5E 0`B1ȉEMEEEEUEEEE 4`4E 0`6E 4J`4E 0`:1E 4`5E 0`>1E 4J`5E 0`B1ȉEE 4`4E 0`6E 4`4E 0`:1E 4`5E 0`>1E 4`5E 0`B1ȉEMEEEEUE EE$E 4`4E 0`6E 4`4E 0`:1E 4`5E 0`>1E 4`5E 0`B1ȉEE 4x`4E 0`6E 4k`4E 0`:1E 4x`5E 0`>1E 4k`5E 0`B1ȉEMEEEEUE(EE,E 4`4E 0`6E 4E`4E 0`:1E 4`5E 0`>1E 4E`5E 0`B1ȉEE 4`4E 0`6E 4}`4E 0`:1E 4`5E 0`>1E 4}`5E 0`B1ȉEMEEEEUE0EE4E 4`4E 0`6E 4`4E 0`:1E 4`5E 0`>1E 4`5E 0`B1ȉEE 48`4E 0`6E 4K`4E 0`:1E 48`5E 0`>1E 4K`5E 0`B1ȉEMEEEEUE8EE<E 4 `4E 0`6E 4`4E 0`:1E 4 `5E 0`>1E 4`5E 0`B1ȉEE 4`4E 0`6E 42`4E 0`:1E 4`5E 0`>1E 42`5E 0`B1ȉEMEEEEUE@EEDE 45`4E 0`6E 4`4E 0`:1E 45`5E 0`>1E 4`5E 0`B1ȉEE 4`4E 0`6E 4`4E 0`:1E 4`5E 0`>1E 4`5E 0`B1ȉEMEEEEUEHEELE 4`4E 0`6E 47`4E 0`:1E 4`5E 0`>1E 47`5E 0`B1ȉEE 4`4E 0`6E 4q`4E 0`:1E 4`5E 0`>1E 4q`5E 0`B1ȉEMEEEEUEPEETE 4`4E 0`6E 4`4E 0`:1E 4`5E 0`>1E 4`5E 0`B1ȉEE 4l`4E 0`6E 4`4E 0`:1E 4l`5E 0`>1E 4`5E 0`B1ȉEMEEEEUEXEE\E 4C`4E 0`6E 40`4E 0`:1E 4C`5E 0`>1E 40`5E 0`B1ȉEE 4u`4E 0`6E 4`4E 0`:1E 4u`5E 0`>1E 4`5E 0`B1ȉEMEEEEUE`EEdE 47`4E 0`6E 4`4E 0`:1E 47`5E 0`>1E 4`5E 0`B1ȉEE 4&`4E 0`6E 4`4E 0`:1E 4&`5E 0`>1E 4`5E 0`B1ȉEMEEEEUEhEElE 4`4E 0`6E 4`4E 0`:1E 4`5E 0`>1E 4`5E 0`B1ȉEE 4`4E 0`6E 4`4E 0`:1E 4`5E 0`>1E 4`5E 0`B1ȉEMEEEEUEpEEtE 4`4E 0`6E 4`4E 0`:1E 4`5E 0`>1E 4`5E 0`B1ȉEE 4H`4E 0`6E 4?`4E 0`:1E 4H`5E 0`>1E 4?`5E 0`B1ȉEMEEEEUExEE|E 4`4E 0`6E 4^`4E 0`:1E 4`5E 0`>1E 4^`5E 0`B1ȉEE 4`4E 0`6E 4`4E 0`:1E 4`5E 0`>1E 4`5E 0`B1ȉEMEEEEUEEEE 4`4E 0`6E 4`4E 0`:1E 4`5E 0`>1E 4`5E 0`B1ȉEE 40`4E 0`6E 4[`4E 0`:1E 40`5E 0`>1E 4[`5E 0`B1ȉEMEEEEUEEEE 4`4E 0`6E 4`4E 0`:1E 4`5E 0`>1E 4`5E 0`B1ȉEE 4T`4E 0`6E `4E 0`:1E 4T`5E 0`>1E `5E 0`B1ȉEMEEEEUEEEE 4`4E 0`6E 4`4E 0`:1E 4`5E 0`>1E 4`5E 0`B1ȉEE 4#`4E 0`6E 4`4E 0`:1E 4#`5E 0`>1E 4`5E 0`B1ȉEMEEEEUEEEEEȃD[]US$ LEEED$E D$E$蛓E$/&E$[]U EЋE1‹E1‹E1Љ‹E1ЉEEЋE1‹E1‹E1Љ‹E1ЉEEЋE 1‹E 1‹E 1Љ‹E1ЉEE ЋE 1‹E1‹E1Љ‹E 1ЉEUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEE$EEE E1EME3EEUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEE,EEE(E1EME3EEUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEE4EEE0E1EME3EEUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEE<EEE8E1EME3EEUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEEDEEE@E1EME3EEUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEELEEEHE1EME3EEUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEETEEEPE1EME3EEUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEE\EEEXE1EME3EEUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEEdEEE`E1EME3EEUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEElEEEhE1EME3EEUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEEtEEEpE1EME3EEUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEE|EEExE1EME3EEUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEEEEEE1EME3EEUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEEEEEE1EME3EEUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEEEEEE1EME3EEUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEEEEEE1EME3EEE1EE‹E U EU EU EE1EU EU EU EU EE1EU EU EU EU EE1EU EU EU EU EUS$/EEED$E D$E$$$$[]U EЋE1‹E1‹E1Љ‹E1ЉEEЋE1‹E1‹E1Љ‹E1ЉEEЋE 1‹E 1‹E 1Љ‹E1ЉEE ЋE 1‹E1‹E1Љ‹E1ЉEUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEEEEE1EMMEE1EUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEEEEE1EMMEE1EUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEEEEE1EMMEE1EUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEEEEE1EMMEE1EUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEEEE|E1EMMExE1EUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEEEEtE1EMMEpE1EUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEEEElE1EMMEhE1EUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEEEEdE1EMME`E1EUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEEEE\E1EMMEXE1EUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEEEETE1EMMEPE1EUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEEEELE1EMMEHE1EUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEEEEDE1EMME@E1EUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEEEE<E1EMME8E1EUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEEEE4E1EMME0E1EUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEEEE,E1EMME(E1EUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEEEE$E1EMME E1EE1EE‹E U EU EU EE1EU EU EU EU EE1EU EU EU EU EE 1EU EU EU EU EUS$8wEEED$E D$E$$$$[]USgvD$!D$\$t !D$LD$\$oD$`ID$L$6tpIH)LD$LD$\$D$ !D$L$tIHD$ D$\$!D$LD$\$D$PID$L$htIH^LD$LD$\$DD$!D$L$tIH DžHH[]ÐUE#EME‹EEEU 9rЃ}0EEEEEE}~UV Dž- ‹E~Dž 1‹ 1‹1‹15y7D$ $5R1Љ Љ !Љ# !Љ 3 3 #33  Љ #33x3| Љ(1Љ3(31Љ3  #( 3 3 Љ3 3 $Љ$3 , Љ`(,1Љ,$Љ0 (1Љ4 08,#4<,#`@$ E܉D$ED$E $ED$E܉$1$@q4[]US$M=EEEUu7 UUtUD$J$~ǃUUt E2%ED$E D$E$%$ E$[]U8DžE E E E U1ȉUЃ1ȉUЃ1ȉUЃ 1ȉ1Љ4 Љ1Љ43 Љ1Љ Љ##3#1Љ 3$# ($3 ,,Љ3(003 D$ $D$$1‹1Љ1‹1ЉD$$WD$$;1‹1Љ1‹1ЉD$$D$$U1ȉUЃ1ȉUЃ1ȉUЃ 1ȉ Љl1Љ8Љ<1Љ@ D$$"1‹1Љ1‹1ЉD$$D$$U1ȉUЃ1ȉUЃ1ȉUЃ 1ȉ Љ1Љp3tt3p1Љx3x| x|#3t p3 Љ33Љ3D$ $D$$1‹1Љ1‹1ЉD$$ED$$)1‹1Љ1‹1ЉD$$D$$U1ȉUЃ1ȉUЃ1ȉUЃ 1ȉ1Љ Љ!Љ# !Љ3 3#33 Љ #333D$ $D$$y1‹1Љ1‹1ЉD$$"D$$1‹1Љ1‹1ЉD$$D$$U1ȉUЃ1ȉUЃ1ȉUЃ 1ȉ Љ Љ31Љ #3##3!Љ3 3# 3 3ЉD$ $fD$$J1‹1Љ1‹1ЉD$$D$$1‹1Љ1‹1ЉD$$D$$dU1ȉUЃ1ȉUЃ1ȉUЃ 1ȉ1ЉD Љ#D33 Љ3D$ Љ( ,3(0 $4 80 $<43D@<3,(3$@38D$ $]D$$A1‹1Љ1‹1ЉD$$D$$1‹1Љ1‹1ЉD$$wD$$[U1ȉUЃ1ȉUЃ1ȉUЃ 1ȉ!Љ1ЉH1ЉLH3P ЉTPЉT#LX!Љ\ Љ`\3Xd Љh3hld3`ppЉ#LtX3l1Љx3t||3xD$ $*D$$1‹1Љ1‹1ЉD$$D$$1‹1Љ1‹1ЉD$$DD$$(U1ȉUЃ1ȉUЃ1ȉUЃ 1ȉ!ЉЉ# !Љ33 Љ 3#31Љ33 33D$ $D$$1‹1Љ1‹1ЉD$$D$$l1‹1Љ1‹1ЉD$$D$$U1ȉUЃ1ȉUЃ1ȉUЃ 1ȉ1Љ Љ1Љ3 Љ1Љ Љ##3#1Љ3#3Љ33D$ $D$$1‹1Љ1‹1ЉD$$eD$$I1‹1Љ1‹1ЉD$$D$$U1ȉUЃ1ȉUЃ1ȉUЃ 1ȉ Љ,1ЉЉ1Љ ##, 33 3,3!Љ Љ3 $$#(3(D$ $D$$1‹1Љ1‹1ЉD$$LD$$01‹1Љ1‹1ЉD$$D$$U1ȉUЃ1ȉUЃ1ȉUЃ 1ȉ Љ\1Љ03\44301Љ838< 8@<#\D@34HH 0LD3L ЉP3HT3TXHЉX3PD$ $D$$1‹1Љ1‹1ЉD$$SD$$71‹1Љ1‹1ЉD$$D$$U1ȉUЃ1ȉUЃ1ȉUЃ 1ȉ1Љ Љ`!Љd`#h dl!Љp3ht px3t|#l3`|3x Љ t#3x3h3lD$ $D$$1‹1Љ1‹1ЉD$$0D$$1‹1Љ1‹1ЉD$$D$$U1ȉUЃ1ȉUЃ1ȉUЃ 1ȉ Љ Љ31Љ #3##3!Љ3 3# 33ЉD$ $tD$$X1‹1Љ1‹1ЉD$$D$$1‹1Љ1‹1ЉD$$D$$rU1ȉUЃ1ȉUЃ1ȉUЃ 1ȉ1Љ Љ#33Љ3 Љ 3 3333D$ $kD$$O1‹1Љ1‹1ЉD$$D$$1‹1Љ1‹1ЉD$$D$$iU1ȉUЃ1ȉUЃ1ȉUЃ 1ȉ!Љ@1Љ1Љ 3@ ЉЉ# !Љ Љ 3$ Љ(3(,$3 00Љ# 43,1Љ834<<38D$ $8D$$1‹1Љ1‹1ЉD$$D$$1‹1Љ1‹1ЉD$$RD$$6U1ȉUЃ1ȉUЃ1ȉUЃ 1ȉ!Љ|ЉD#DH |L!ЉP3LTT3H ЉX P\3X`#Ld`3\1Љh3|l3Pph dtl Dxx3p3tD$ $ D$$1‹1Љ1‹1ЉD$$D$$z1‹1Љ1‹1ЉD$$#D$$U1ȉUЃ1ȉUЃ1ȉUЃ 1ȉ1Љ Љ1Љ3 Љ1Љ Љ##3#1Љ3#3Љ33D$ $D$$1‹1Љ1‹1ЉD$$sD$$W1‹1Љ1‹1ЉD$$D$$U1ȉUЃ1ȉUЃ1ȉUЃ 1ȉ Љ1ЉЉ1Љ ## 3333!ЉЉ3 #3D$ $D$$1‹1Љ1‹1ЉD$$ZD$$>1‹1Љ1‹1ЉD$$D$$U1ȉUЃ1ȉUЃ1ȉUЃ 1ȉ Љ1Љ331Љ3 #3 3 Љ33Љ3D$ $D$$1‹1Љ1‹1ЉD$$aD$$E1‹1Љ1‹1ЉD$$D$$U1ȉUЃ1ȉUЃ1ȉUЃ 1ȉ1ЉT Љ !Љ$ #T( $,!Љ03(4 0834<#,@@3 D<38 ЉH 4L#HPD38P3L(3,D$ $D$$1‹1Љ1‹1ЉD$$>D$$"1‹1Љ1‹1ЉD$$D$$U1ȉUЃ1ȉUЃ1ȉUЃ 1ȉ Љ ЉX3X\1Љ` \d#hh3\#`ld#`p3ht!Љxl3`|\ xp3t#d| xl33ЉD$ $肾D$$f1‹1Љ1‹1ЉD$$D$$1‹1Љ1‹1ЉD$$蜽D$$耽U1ȉUЃ1ȉUЃ1ȉUЃ 1ȉ1Љ Љ#33Љ3 Љ 3 3333D$ $yD$$]1‹1Љ1‹1ЉD$$D$$1‹1Љ1‹1ЉD$$蓺D$$wU1ȉUЃ1ȉUЃ1ȉUЃ 1ȉ!Љ1Љ1Љ3 ЉЉ#!Љ Љ3 Љ33Љ#31Љ33D$ $FD$$*1‹1Љ1‹1ЉD$$ӷD$$跷1‹1Љ1‹1ЉD$$`D$$DU1ȉUЃ1ȉUЃ1ȉUЃ 1ȉ!Љ<Љ# < !Љ3 3 Љ 3 # $ 31Љ(3<,30( $4, 883034D$ $D$$1‹1Љ1‹1ЉD$$褴D$$舴1‹1Љ1‹1ЉD$$1D$$U1ȉUЃ1ȉUЃ1ȉUЃ 1ȉ1Љt Љ@1ЉDt3@ ЉH1ЉL ЉP#HTP#DXT3X#X\1Љ`\3Pd#Lhd3LllЉ3hpp3`D$ $D$$ر1‹1Љ1‹1ЉD$$聱D$$e1‹1Љ1‹1ЉD$$D$$U1ȉUЃ1ȉUЃ1ȉUЃ 1ȉ Љ1ЉxЉ|1Љ |#x# 3x333!ЉЉ3 #3D$ $ۮD$$迮1‹1Љ1‹1ЉD$$hD$$L1‹1Љ1‹1ЉD$$D$$٭U1ȉUЃ1ȉUЃ1ȉUЃ 1ȉ Љ1Љ331Љ3 #3 3 Љ33Љ3D$ $D$$ƫ1‹1Љ1‹1ЉD$$oD$$S1‹1Љ1‹1ЉD$$D$$U1ȉUЃ1ȉUЃ1ȉUЃ 1ȉ1Љ Љ!Љ# !Љ3 3#33 Љ #33 3D$ $迨D$$裨1‹1Љ1‹1ЉD$$LD$$01‹1Љ1‹1ЉD$$٧D$$轧U1ȉUЃ1ȉUЃ1ȉUЃ 1ȉ ЉP Љ31Љ $#P((3# ,$# 03(4!Љ8,3 < 8@034D#$H< 8L,3@L3HDЉD$ $营D$$t1‹1Љ1‹1ЉD$$D$$1‹1Љ1‹1ЉD$$誤D$$莤U1ȉUЃ1ȉUЃ1ȉUЃ 1ȉ1ЉE ЉT#EX3T\\3X``Љ3Ed Љh `l3hp dt Xxp d|t3EE|3lh3dE3xD$ $虢D$$}1‹1Љ1‹1ЉD$$&D$$ 1‹1Љ1‹1ЉD$$賡D$$藡U1ȉUЃ1ȉUЃ1ȉUЃ 1ȉ!ЉE1ЉE1ЉEE3EE ЉEEЉE#EE!ЉE ЉEE3EE ЉE3EEE3EEEЉ#EEE3E1ЉE3EEE3ED$ $ƟD$$誟1‹1Љ1‹1ЉD$$SD$$71‹1Љ1‹1ЉD$$D$$ĞU1ȉUЃ1ȉUЃ1ȉUЃ 1ȉ!ЉEЉEċ#EĉEȋ EE̋!ЉEЋ3ẺEԋE3Eȉ ЉE؋ EЉE܋3E؉E#ẺEE3E܉1ЉE苅3EE싅3EЉEE EEE EĉEE3E3EU1ȉUЃ1ȉUЃ1ȉUЃ 1ȉEUUU U(Dž E E E E U1ȉ UЃ1ȉ UЃ1ȉ UЃ 1ȉ !ЉD Љ D#331Љ Љ$$ (1Љ, Љ03(34#08 Љ<, D@<34@38 U1ȉ UЃ1ȉ UЃ1ȉ UЃ 1ȉ D$$_D$$_1‹1Љ1‹1ЉD$$A_D$$%_1‹1Љ1‹1ЉD$$^D$ $^1ЉЉH#L HP LT1ЉX#P\ H`T3\d`3XdЉ!ЉhT#lh3pl3\t Hx1Љ|t3|p3x U1ȉ UЃ1ȉ UЃ1ȉ UЃ 1ȉ D$$\D$$m\1‹1Љ1‹1ЉD$$\D$$[1‹1Љ1‹1ЉD$$[D$ $[!Љ31Љ#!Љ3!Љ3 Љ3 Љ331Љ3 U1ȉ UЃ1ȉ UЃ1ȉ UЃ 1ȉ D$$zYD$$^Y1‹1Љ1‹1ЉD$$YD$$X1‹1Љ1‹1ЉD$$XD$ $xX Љ Љ#31ЉЉ#3 333 3333 U1ȉ UЃ1ȉ UЃ1ȉ UЃ 1ȉ D$$qVD$$UV1‹1Љ1‹1ЉD$$UD$$U1‹1Љ1‹1ЉD$$UD$ $oU Љ Љ331Љ##333 # !Љ33 3 U1ȉ UЃ1ȉ UЃ1ȉ UЃ 1ȉ D$$bSD$$FS1‹1Љ1‹1ЉD$$RD$$R1‹1Љ1‹1ЉD$$|RD$ $`R1ЉT1Љ !Љ$ ((3T Љ, Љ0Љ4#,8$ 4<#0@ #,D<38@3D!ЉH1ЉLH3EE1‹E1‹E1ЉEEE1‹E1‹E1ЉEċEE 1‹E 1‹E 1ЉEȋE E 1‹E1‹E1ЉE̋EXEĉEȉ\ẺEEEEEEĉEEċEȉEEȋẺEE̋EhEĉEȉlẺEEEEEEĉEEċEȉEEȋẺEE̋EEEĉEȉEẺEEEEEEĉEEċEȉEEȋẺEE̋EȉEẺ$EEEEEEĉEEċEȉEEȋẺEE̋EEEĉ0EȉEẺ4EEEEEEĉEEċEȉEEȋẺEE̋EEEĉ8EȉEẺE‹EUET$E D$ $$ 3EE$[]US$-CEEUEE D$ T$ED$ $$T3$[]US$i-EEUEE D$ T$ED$ $q$T>3$[]USD-âD$nD$$\oD$D$$ D$nD$$toD$D$$D$oD$$t@oD$nD$$oD$D$$=D$nD$$tho)D$D$$5D$oD$$toD$ nD$$oD$D$$oD$nD$$Jto^D$D$$jD$oD$$to DžD[]ÐU0E@UE DU]USc*@Ut2@UDUD$D$ ED$xD$ $҃[]US4*ÚE@$OEE$kEEEE$Dtx$.$Dt $..}t}w)E$>ED$$nED$ ED$ED$E$ED$E$ tED$E$ٰ*ED$E$°ED$E$ED$E$x%$tC$+ D$E$%$8C$-E$s=$Cu $ E4[]US4'ÇEE $%EE $t%EE $f%EEE܋E@EE@EE@ ED$E D$E$k%ED$ ED$ED$E$LE܉D$ ED$ED$E$OtED$ED$E$ݦE܉D$ ED$ED$E$uEE$$E$$E$$E4[]UST&T}uo} v} w ET} u EB} u E0} u E} <u E E7}v}w Et E7E;E w } <v E7茖t'} w E7}t E7EE@E@E$EԋE@$E؋E@$E܋Eԉ$;E t*xD$ D$%xD$x$)E؉$赫;Et*xD$ D$&xD$y$($EE-ED$D$ ED$E D$$0EԋE$E؋E؉$";Et*xD$ D$0xD$y$R(Eԋ@$ ED$EԉD$E$*E؉D$ED$E$Eԋ@$E$ !ED$ED$E$誣EԉD$ ED$ED$E܉$D$E܉$wt}t EEEĉE$}>t/}t 'yE 8yEȋEȉD$9y$v(}w*xD$ D$IxD$Oy$'E؋@$xED$E؉D$E$E$=t $.u}uEED$$gE;ED$$gED$ED$E$VE$7ED$ D$ED$E$cED$E$D$E$-ED$E$qE$L7E$E$Eԋ@$EEԉD$ ED$E܉D$E$$@E؋E؅t U؍E؃D$D$$HE܋UM܋E(D$ E$D$E D$EЉD$EԉD$T$ L$ED$E $EE؉$=}_EЉ$%EED$D$E$(EԉD$ED$E$EЉ$E$ ED$ED$E$諜EЉD$ ED$ED$E$D$E$xtE$mE$7t $.(D$ED$E$`ED$E$>D$E$~EԉD$E$蕬yEЉ$EEЉD$ ED$ED$E$$6$ ~EЉD$\y$EԉD$cy$ED$jy$ED$qy$ED$xy$}ED$z$hUЋEEUԋEPEUEBEUEB EUEBEU,EEEЉ$Eԉ$E$E$E$E$E$}ED$E$E$cEE@$LE@E@$4E@E@ $E@ E@$E@yD$D$ yD$D$.x$]E2}t>E E$$/E$E(E,$E,EEȋEȃd[]US$E@ @$ EEEHE@T$ L$D$E$/E@ D$E$葩EE$E$[]US$ÛE@$EEEHT$ ED$L$E$E@D$ED$E$SE@$O EE@D$ED$E$蒸E@$ EEPED$T$E$׿ED$ED$E$JE@D$ ED$ED$E $E$ E$ E$ $[]USDxD$E$臧~E@D$E$x ED$E $K~E@D$E $էx EjE@@$ EE@@$ EE@@$ EE@$ EE@D$E D$E$ E@D$ ED$ED$E$iE@D$ ED$ED$E$FE@E܋EEЋE@ EEEEEED$ EЉD$E܉D$E$E@D$ED$E$ED$E$蘦EE$ E$ E$ E$ EEȋEȃD[]UVSwEEEEEED$ D$E$x}=D$&zD$E$7E}ED$D$E$?E܃}tE0vE$5DžDAED$E܉D$R$EƄRD$D$R$EċE$Y5D$,zD$E$7E}tEE$!5D$:zD$E$6ED$GzD$E$6E}tEE$4D$SzD$E$q6E}tEE$4D$azD$E$96E؃}}u }u} t%E؉$J4Eȉ$?4DžD7D$hzD$E؉$5ED$D$E$|>EE$3D$jzD$E؉$5ED$D$E$3>EE$3D$lzD$E؉$F5ED$D$E$=EE$U3E؉$J3EtEtEu;E$vE$kE$`Eȉ$ 3DžDE$E E$ۘEă}u}u}u ͂)ED$$ED$ ED$ED$ED$EЉD$EȉD$ EĉD$E D$E$EEȉ$g2}EUMEuT$L$D$t$ pzD$D$E$[$ E}tZE$IEE$7EE$%EE$EE$EE$c&E$1ED$ED$ẺD$ EĉD$E D$E$EE$E$E$}UEUEUEU EUE} EuEuE EEEEEtEEuދE2$0$E}u ZED$zD$E$EEt#D$zD$E${E}t~D$ zD$E$R EE'D$zD$E$&EEE;E|D$zD$E$ED$zD$E$EED$$$E}u :EEEtEUEEE%EUEEEEE;E|ӋEEED$ ED$D$E $oY$EE$#E$t#E2EE$ EEEE;E|ƋE}t7E(EE$ EEE}~ҋE$ .EDD[^]UE]U(D$ED$ED$D$ D$E D$E$@U(EE t0E t$E tE t E u EJE EE EE EE EE EE$uEEUVS0 E}t9Et0Et$EtE t Eu EEEEEEEE EEEE@$‹E u E@$E E ED$ ED$T$ $E0[^]U8EEt?Et3} t-Et$EtEt E u E[EEEEEEE EEEED$ E D$T$ $uEEUS hE $H[]US4 CEEEED$ K {D$D$E$UE}u(D$ KzD$D$E$UE}tl{EUE D$T$E$;E}t {EbUMED$T$ $E}t {E5UMED$T$ $EE$8t {EE$*E$ *E$*E4[]UE$US4T }EE{ED$ @qD$D$E$TE}u(D$  uD$D$E$bTE}tE$)Ep{EE$E}tE$EC{EEUD$$E}uE$(E$(EGE$(E$(}t$ED$ ED$D${$EE2E؃4[]UEtE$EEEÐUS4\|EE $WEE $IEE $;EE $-EEEE@ED$E D$E$DED$ED$E$ED$E$茗ED$ED$E$ED$E$YD$E D$E$ED$ED$E$ED$ED$E$ED$E$uPD$ED$E$2ED$ED$E$ED$E$誖tEE$E$E$E$E4[]US$ÓzEED$E D$E $‰E $EE D$ED$E$EE$uD$E D$E $>E$[]USTvzut'} w E7k}t E7Y}t EEEȉEE tE }uE$E}uD$)E$MED$E$gE $\EEEЉẼ}t Ẻ$m}t EЉ$\}tVE ED$ aD$ED$$SE̋E ED$ aD$ED$$)ERE D$ D$ED$$E̋E D$ D$ED$$ՒEЋEЉD$Ẻ$"~EЉD$Ẻ$EЉD$ẺD$E$E$;E E̋@$E܋E̋@$EE $EE $EE $ED$ẺD$E܉$D$EЉD$E$ED$E܉D$E$kED$E܉D$E$ED$ED$E$@}t }D$D$$1D$ED$E$/ED$ED$E܉$袞tE $ EԋED$ED$Eԉ$?E $E؋EЉD$ẺD$E؉$$ẺD$$EЉD$$ED$$ED$$ED$$ED$$xED$$cEԉD$$NE؉D$$9E܉$E$E$E$E$UEUEBUẺB UEЉBUEԉBUE؉BE @D$E$E$zEE@$cE@E@ $KE@ E@$3E@E@$E@E@$E@ȁD$D$ }D$D$C$\yE2EEăT[]US$]tE$xED$ED$E$ED$E$苇ED$E$E$;Et*D$ D$]D$$E$[]US$+ös$eED$D$eE$D$dE$E$[et*$D$ D$lD$8$E$[]UVS sE}uE} vE tDžd7%}wDžd7EuDžd7EEEEEE}E $ EE $EE$E $EEUD$T$E$ނE$‹E d9vE$OCE;E3E+EbhpEtlxE|pEEEsEEEwEEE{EEEEEE`EpD$D$E$E}t2EtD$D$E$'E$EEpuEEttEEpuދEpt>EEt$EEpuDždE$EȋUMuD$D$EȉD$ T$L$4$荫EUMuD$D$EȉD$ T$L$4$ZEċE$IEE$7EE$%EE$EE$EE$E}t}u0E$Eĉ$Eȉ$DždEĉD$E$ ~EĉD$E$EE $>E̋EĉD$ED$Ẻ$E $.E؋E $E܋E $ED$ED$E؉$~D$EĉD$E܉$~E܉D$E؉D$E$脡E $EED$EȉD$E$!u*ZD$ D$ D$~$E܉D$E؉D$E$ڕE؉EEE܉$SEED$ED$E$$E$(EEEEED$EȉD$EЉ$2EEEEĉD$ED$Eԉ$ $Et$ED$$EĉD$$ẺD$$EȉD$$EЉD$$jEԉD$$UUẺUEȉBUEB UEĉBUEЉBUEԉBE @D$E$5E$EE@$E@E@ $E@ E@$E@E@$nE@E@$VE@ȁD$D$ ZD$D$6$pDžd2 Džddİ[^]US$ãkE@ @$EEPE@ T$D$E$XED$E$EE$}$[]US$*kE;E uWE @$&EEE@T$ D$E D$E$8ED$E$6E$%%EE@T$ D$E D$E$$[]US$ÎjE@ tE@t E@u*EE@T$ D$E D$E$虥E@$EE@$EE@$EE@ D$D$E$6yEPED$T$E$ՆE@ D$ ED$E D$E$E@D$D$E$xEPED$T$E$yE@D$ ED$E D$E$蚤ED$ED$E$yE@tE@D$ED$E$uEPEHT$ ED$L$E$ޟE@ D$ED$E$赛ED$ED$E$(uE$E$E$$[]US$yhE$[z$EE$Ez$vEED$ ED$E D$E${ED$ ED$ED$E$E$AE$[]US$\gE$y$EED$ ED$E D$E$訞E$[]UST ÖgEEE}t"D$łD$E$EEEȉE}u8D$҂D$E$E}tEE$}u}u bẺD$ED$ ED$E D$EЉ$EE$}} E̅D$ D$ۂD$E $=E}EЉ$EEԉ$EE܉$}EE$kEE؉$YEE$GE[D$D$E$E}tEE$ED$ ED$E D$EЉ$E}u?UЋEUEԉUE؉U E܉UEUEET[]U(D$ED$ED$D$ ED$E D$E$qU(EE EE EE EE EE EE EEtEtEu EDE$uEEUS$ÀdEEEEE@$s‹E E ED$ED$$$[]UVSPdEEEEE̋EEЋEEԋE E؋EE܋EEẺ$u$EEẺ$u$EẺ$su$EẺ$]uD$D$E$ẺD$ED$E$肚ẺD$ED$E$蝎u E?Eu'ŰMЋE0T$ L$ED$4$`EEEẺD$ED$E$%Eu@E$LEE$ẺD$ED$E$EE$Eu!E$E$E$U EEEăP[^]US4%bEEEEEEE EEEEEE@$‹E E ED$ED$$4[]US$ÙaEEEE$EEED$T$E$ E D$E$}t EEEEE$dE$[]US aE $r[]US$Z`D$D$E $E}u EDbED$D$E$XE}uE${ ED+ED$ED$E$(\E$N EE$[]US49`EEEED$ KD$D$E$6E}u(D$ K D$D$E$6E}t̃EUE D$T$E$1E}t EbUMED$T$ $E}t E5UMED$T$ $EE$8t EE$ E$ E$ E4[]UE$UE]US$A^D$D$E$g E}u ED$#D$E$5 EE$b }u EiD$'D$E$ EE$( }u E/D$D$E$EE$ EEE$[]USDQ]EEEEEEEEEE$ED$ED$E$ED$ )D$D$E܉$ 3E}t̃E:U܋ED$T$E؉$E}tGE E؉$!E}uXEED$E$xuyEU؋E D$T$Eԉ$E}tEED$T$$/ E}t D$D$E$EED$D$$E}u EED$E$wt ɄEE$E$)Eԉ$E$E؉$E܉$E$ED[]US4 Ø[EE҄ED$  |D$D$E$I2E}u(D$ <@D$D$E$2E}tE$EڄEE$mE}tE$EgEEUD$$E}uCEEUD$$E}uE$E$zEGE$fE$[}t$ED$ ED$D$$EE2E؃4[]UEtE$iEEEUYEHUE LU]USCYHUt2HULUD$D$ ED$4D$ $҃[]UG{YE"E';ErE'E EE'uЋEEEUSDY$EE $EE $EE $EEEE܋E@EE@ED$E D$E$E܉D$ ED$ED$E$w ED$ ED$ED$E$ ED$E$ttMED$ ED$ED$E$\ E܉D$ ED$ED$E$~ uME$;E$0E$%E$}t^}uXEt ;E GE̋Et HE GEЋẺD$EЉD$X$}th$tXEt ;E GEԋEt HE GE؋EԉD$E؉D$X$ED[]US4cV$E܋E@$EE$_EE$hEE} t@E$‰EE;Er&{D$D$$oEEEE$t$D$ED$E$je}t}w#E$D$E$&E$.-E$d$t $ E$E$E܃4[]USDdTE $fE܋E $EEtE$BEED$ED$ ED$E D$$}ED$E؉D$E܉$5cUEE;E r D$D$$$E$E$tED$$E$t $.z}tm}w)E$ED$$#EZD$$#ED$ED$E$*E$ED$$`#EED$ D$ED$E$ED$E$fD$E$mE܉D$E$'nE$E $QEE؉D$ ED$ED$E$o$it`$ %E؉D$˅$XED$ԅ$CED$݅$.ED$$UE؉UEBUEBUEB E܉$E @D$D$E$7D[]USDNQEE@E@E@ E$ cE}?vE;E r E7bE $EE $ZEEtE$EED$ED$ ED$E D$$yzED$ED$E$_$tED$$D$E$kk~ED$E$kx-E$cE$XE$ME7eE $EED$ ED$ED$E$"$t`$ ED$˅$ ED$ԅ$ED$݅$ED$$̢UEUEBUEBE$‹EP E$kE @D$D$E$tgE$=EE@$&E@E@$E@E@ $E@ EEE؃D[]US$ÂNE@@$EEEH E@T$ L$D$E$蔉E@D$E$iEE$sE$[]US$uNED$$EEEHT$ ED$L$E$EEHT$ ED$L$E $ED$ ED$E D$E $sE$$[]US$YME@$ EEE@ T$ D$E D$E$oED$ED$E$|xED$ ED$ED$E$ۃE$1$[]US$6LE@$EE@$EE$.ED$ED$E$[ED$$`EEEHT$ ED$L$E$膇EP ED$T$E$ED$ ED$ED$E$N]ED$ED$E$YwED$ ED$ED$E $躂E$E$E$E$$[]USDKD$E$f~ED$E$gx EE@$JEE@$9EEE@T$D$E$zvEEEEЋE@EEEԋEEE EEEED$ EЉD$ED$E$˓D$E$eEE$E$EEȋEȃD[]US4XJE}t^D$ D$E$E}t8D$D$E$EE$}u Ez}t%ED$ ED$E D$E$gE ED$E D$E$3EUEUEUEU EEE؋E؃4[]U(ED$E D$E$UEUEUEU EU(EE t$E tE t E u E?E EE EE EE EE$uEEUVS ÁHE}t!EtEt Eu EpEEEEEEE@$2‹E u E@$E E ED$ ED$T$ $E [^]UVS02ýGEEt9Et-Et$EtEt E u EgEEEEEEE EE@$‹E EE0E ED$ L$t$$E0[^]UVS0\FE}t-Et$EtEt E u E{EEEEEEE EE@$‹E u E@$fE E ED$ ED$T$ $VE0[^]U(EEt3Et'} t!EtEt Eu EPEEEEEEEEED$ E D$T$ $uEEUSfEE $FW[]ÐUDEEPUE TU]USEE ET$$fE PE@T$$NE PE@T$$6[]US5DE$ EE@$E@E@$E@E $E@$E@[]UWVS,:DE $E؋E$E܋E$EE؃ $E D$E؃ $E$${E}uE,[^_]US$"íCD$D$ ED$D$E$脚E}tE$%D$$oE$[]US$BC$E$4E$%E$EE D$ ED$ED$E$2~E E HT$ ED$L$E$yE E @T$ D$ED$E$SE D$ ED$ED$E$SE$E$E$E$[]US$U E D$ EԉD$ED$$E}t EE$EԉD$Ȟ$襑E؉D$۞$萑E܉D$${ED$$fED$$QED$'$<ED$:$'$tE D$P$ED$$9EEȉ$oE؋UԉD$$EED$ Eԃ D$ED$Eȉ$Eԉ$‹EE؉$‹EPE܉$‹EPE $U Eԃ D$$E$t‹EPE$UEȉD$$}E$>‹EP(}t;}t5U ED$ T$ED$E$tp$k}t;} t5UED$ T$E D$E$tp$*E$Eȉ$KE$OEԉ$E @D$E$EET[]UWVS%ð;E $EԋE $E؋E $E܋E $EE $zE$t$E$7xE|$$}xE$ED$E$D$E D$Eԉ$ED$ ED$ED$Eԉ$@t$ED$ ED$ED$Eԉ$t̟$x$t$E$E$]E$mE$qE$fE܉$[E؉$PEԉ$Ee[^_]US4H9$۷EUE@ T$$[EEEHE@T$ L$D$E${pED$E$7Ut*$t$EE@D$$PTu*$rtL$EE$EPET$$EU EHED$ T$L$E$ ED$$St@$t|$E$E$EE@$D$$jSu5$t$E$EU EH(ED$ T$L$E$TUE@9uLEUR 9u?EUR$9u2$ tܠ$$E$GEE$3E$EE؃4[]USDX7EE$RE$CE$4E$%EEԉ$D$E$D$E$E PE T$$EUE$ E @D$$OEU ED$ T$ED$Eԉ$ED$ EԉD$D$E$t*$t$EE @D$ED$E$NmD$E$Q3E PE H(T$ ED$L$E$lE @D$ ED$ED$E$FE @D$ED$E$aE @D$ ED$ED$E$`lD$E$xPBE$Eԉ$E$腶E$zE$oE$dE$YED[]UST[4ED$E$O~E @D$E$xPx EMD$E$O~E @D$E$EE3E3EMEnD$ $EE3E3EMEԍnD$ $EE3E3EMEnD$$EE3E3EMEnD$$EE3E3EMEnD$ $]EE3E3EMEЍnD$ $0EE3E3EMEnD$$EE3E3EMEȍnD$$EE3E3EMEnD$ $EE3E3EME؍nD$ $|EE3E3EMEnD$$OEEMEE@MEPE@MEPE@ MEP d[]UEM EE]US$ÝE EEEE@T@u:ED$E$$$hE@TE@PEP}E@TtX$EHTEETQEPTEm}t E@T?~D$D$E$7}t~$hU3ED$E$sE@TE@PEPm@E@}?w$EHTEETQEPTEm}t E@T?~˃$[]US4连JEED$D$E$zE@EEEEEEEE@TEE;EsEEEeeE EE@T7=EPTEDEPTEPTEDEPTE@T7~tEPTEDEPTEPTEDEPTE@T?~D$D$E$ED$8D$$fqE‹EPLE‹EPME‹EPNE‹EPOE‹EPPE‹EPQE‹EPRE‹EPSED$E$T$hEEUEEUE@EUE@EUE@ E4[]UEEEÐUEEE#EgE@E@ܺE@ vT2E@E@TUStPEEE@EE@EE@ EEED$@E D$E$pE3E#EU1‹EE-[(EED$E$EMME3E#EU1‹EE-H8EED$ E$EMME3E#EU1‹EEp $EED$E$rEMME3E#EU1‹EE-1B>EED$E$1EMME3E#EU1‹EE-Q EED$E$ EMME3E#EU1‹EE*ƇGEED$ E$ EMME3E#EU1‹EE-WEED$E$n EMME3E#EU1‹EE-jEED$E$- EMME3E#EU1‹EEؘiEED$E$ EMME3E#EU1‹EE-QtEED$ E$ EMME3E#EU1‹EE-OEED$E$j EMME3E#EU1‹EE-B(vEED$E$) EMME3E#EU1‹EE"kEED$E$ EMME3E#EU1‹EE-mgEED$ E$ EMME3E#EU1‹EE-rYEED$E$f EMME3E#EU1‹EE!IEED$E$% EMME3E#EU1‹EE- ED$E$ EMME3E#EU1‹EЍE-L?ED$ E$ EMME3E#EU1‹EEQZ^&ED$E$t EMME3E#EU1‹EE-V8IED$E$9 EMME3E#EU1‹E̍E-)ED$E$ EMME3E#EU1‹EESDED$ E$ EMME3E#EU1‹EE-^'ED$E$ EMME3E#EU1‹EȍE-8,ED$E$M EMME3E#EU1‹E܍E!ED$E$ EMME3E#EU1‹EE-*E}uQqED$D$D$ D$D$$ l>E}u E1} t$ED$ ED$D$ $E E2E4[]US4}xED$ D$D$  D$D$$=E}}ED$ ̤D$D$ 88D$D$$u=E}uQqED$ D$D$ D$D$$-=E}u E1} t$ED$ ED$D$$E E2E4[]U(EE}t} t.ED$E $VEED$E $~EEEÐUEEEɼ@g jE@;ʄ@ gE@+@rn+@,hE@0kA@4كE@8y!~@<[E@@@DEǀUEEE؞@]ˋE@|6@ *)bE@p0@ZYE@9Y@/E@ 1 @$g&3gE@(Xh@,JE@0d@4 . ۋE@8O@<HGE@@@DEǀUWVS\zyEPEUEP @EUEP@EUEP@EUEP$@ EUEP,@(EUEP4@0EUċEP<@8EȉUEEU܃E E U܃E E U܃E E U܃E E U܃E E U܃E E U܃E E E E܈E EE}aEEԉEԃƉ׉Eԃ1Ƌ1׋Eԃ11Mԃ׉EԃƉ׉Eԃ1Ƌ1׋Eԃ11׋EԃE}OEEUƉ׉EU1Ƌ1׋EU11Ɖu}̉EU}!ljE!ЉMuЉҋu!Ƌ}!׋11׋EԋÄÀ׋EԋEUEUƉ׉EUƉ׉11u}11EUu!Ƌ}!׋MEE!ȋ#U11щ   EUu!Ƌ}!׋1 1EUEUĉEȉŰEUEUċEUEUEUEUEUEUEUEUEUEUEUEUEUEUE}OHEPEUMQEP @EUMAQ EP@EUMAQEP@EUMAQEP$@ EUMA Q$EP,@(EUMA(Q,EP4@0EUċMA0Q4EP<@8EŰMA8Q<\[^_]US$3tþE EEEE=uFEHD$E$$zEǀEPD@@MA@QD} E*EEETHQEEm}tE~D$D$E$}?ED$E$8EǀEPD@@MA@QDEm}w$ y*EEETHQEEm}tE~ƒ$[]UWVSLr/EED$D$E$>E̋PD@@EЉUԋEЋUEUEЋUԉ1E؉U܋EUEЉUԋE̋EUEUEUU;UwE;ErU;UsEUEUEЉUԋEU҉EUE؋U҉E؉U܋EЋUԉƉ׉1E U E؉U܋E̋oOE̋EDHẺE̋EDHẺE̋o~E̋EDHẺE̋EDHẺE̋~D$D$E$ẼHD$pD$$DE؋U܉1‹ËE؋U܉1‹ËE؋U܉1‹ËE؋U܉1҉‹ËE؋U‹ËE؋U‹ËE؋U‹ËE؉‹ËEU1‹ËEU1‹ËEU1‹ËEU1҉‹ËEU‹ËEU‹ËEU‹ËE‹ËẼHD$Ẻ$I$NuẼHEE̋P1‹EEE̋P1‹EEE̋P1‹EEE̋P1҉‹EEE̋P‹EEE̋P‹EEE̋P‹EEE̋P‹EEE̋P @1‹EEE̋P @1‹EEE̋P @1‹EEE̋P @1҉‹EEE̋P @‹EEE̋P @‹EEE̋P @‹EEE̋P @‹EEE̋P@1‹EEE̋P@1‹EEE̋P@1‹EEE̋P@1҉‹EEE̋P@‹EEE̋P@‹EEE̋P@‹EEE̋P@‹EEE̋P@1‹EEE̋P@1‹EEE̋P@1‹EEE̋P@1҉‹EEE̋P@‹EEE̋P@‹EEE̋P@‹EEE̋P@‹EEE̋P$@ 1‹EEE̋P$@ 1‹EEE̋P$@ 1‹EEE̋P$@ 1҉‹EEE̋P$@ ‹EEE̋P$@ ‹EEE̋P$@ ‹EEE̋P$@ ‹EEE̋P,@(1‹EEE̋P,@(1‹EEE̋P,@(1‹EEE̋P,@(1҉‹EEE̋P,@(‹EEE̋P,@(‹EEE̋P,@(‹EEE̋P,@(‹EEE̋P4@01‹EEE̋P4@01‹EEE̋P4@01‹EEE̋P4@01҉‹EEE̋P4@0‹EEE̋P4@0‹EEE̋P4@0‹EEE̋P4@0‹EEE̋P<@81‹EEE̋P<@81‹EEE̋P<@81‹EEE̋P<@81҉‹EEE̋P<@8‹EEE̋P<@8‹EEE̋P<@8‹EEE̋P<@8‹EEL[^_]UEEEHUS4h.ED$0D$D$ AD$D$$ (E}}EED$0TD$D$ pD$D$$ +(E}uQED$0 D$D$ D$D$$ 'E}u E1} t$ED$ ED$D$ =$E E2E4[]US4dgED$@DD$D$ AD$D$$ D'E}}EED$@D$D$ pD$D$$ &E}uQED$@̩D$D$ D$D$$ &E}u E1} t$ED$ ED$D$ =$E E2E4[]U(EE} t} t.ED$E $VEED$E $~EEEUEEEͫ@gE#E@2Tv@ E@@E@\E@XUWVSd{eEEȋEE̋EPE؉U܋E PEUEPEUMȋűE1ȋU1EUEU@0D0UMEUƉ%D8@8u1Ƌ}1׋EUEUUM1ɉUMEUD@@@1M1щMEUEUEUƉ׉1%@HDHE1U1)EU܋EUƉ%@HDHUMEUƉ%D@@@u1Ƌ}1׋EUEUUM1UMEUD8@81M1щMċEUĉEUċEUƉ׉1%@0D0E1U1EUEMȋueщʉEUEUME؋U܉QM EUQMEUQd[^_]U8EPEUE PEUEPEUEHED$T$ L$ED$ED$E$EHED$T$ L$ED$ED$E$EHED$T$ L$ED$ED$E$EHED$T$ L$ED$ED$E$E HED$T$ L$ED$ED$E$OE(HED$T$ L$ED$ED$E$E0HED$T$ L$ED$ED$E$E8HED$T$ L$ED$ED$E$EUMQEUM QEUMQUWVxEHUME80x5򥥥u})׉MQME0xu}E0xE1U1QME0xEPQME0xu}E0xu}E0xЉ҉ƉE1U1u})׉QM E 0xu}E0xE1U1QM(E(0xE PQM0E00xu}E(0xu}E 0xЉ҉ƉE1U1u})׉QM8E80xu}E00xE1U1QE0xE8PMQME0xu}ċE0xuȉ}̋E80xЉ҉ƉE1U1u})׉QME0xuЉ}ԋE0xE1U1QME0xEPQM E 0xu؉}܋E0xu}E0xЉ҉ƉE1U1u؋})׉QM(E(0xu}E 0xE1U1QM0E00xE(PQM8E80xu}E00x5ͫgE#u})׉Qx^_]UWVSC]D$@E D$E$1EPE؉U܋E؋U܉EЉUԋEP @EUEUEȉŰEP@EUEUEUD$ED$ ED$EȉD$EЉ$E$D$ED$ EȉD$EЉD$E$tE$ZD$ ED$ EЉD$ED$Eȉ$AuЋ}ԋE1U1EЉUԋEȋU+EUEȉŰEUEUEUċEЋUԋMQEȋŰMAQ EUċMAQČ[^_]US$[SE EEEE@X@u:ED$E$B$aE@XE@\PEP\}E@X$EHXEETQEPXEm}t E@X?~D$D$E$3}t~3ED$E$E@XE@\PEP\m@E@}?w$`$EHXEETQEPXEm}t E@X?~˃$[]US4qZEED$D$E$vE@\EEEEEEEE@XEE;EsEEEeeE EE@X7=EPXEDEPXEPXEDEPXE@X7~tEPXEDEPXEPXEDEPXE@X?~D$D$E$ED$8D$$-E‹EPPE‹EPQE‹EPRE‹EPSE‹EPTE‹EPUE‹EPVE‹EPWED$E$n$^EEEP1‹EEEP1‹EEEP1‹EEEP1҉‹EEEP‹EEEP‹EEEP‹EEEP‹EEEP @1‹EEEP @1‹EEEP @1‹EEEP @1҉‹EEEP @‹EEEP @‹EEEP @‹EEEP @‹EEEP@1‹EEEP@1‹EEEP@1‹EEEP@1҉‹EEEP@‹EEEP@‹EEEP@‹EEEP@‹EE4[]UEEEUS$%VðEED$D$E$)$[]UWVSlUrEE쉅EE Ɖ׉U E¸ Ƌ ׋U E¸ щU E¸ Ƌ ׋U E щU E Ƌ ׋U E щU E DTE}E#MUEЋRhlE}vE#MUEЋR(,E}vEMME싴(,EtŨ|Ŭ11(,E}vE,hlƉ׉1%EUƉ׉1%1Ƌ1׋EU111щEUƉ׉1%1Ƌ1׋EU11щEUƉ%1Ƌ1׋x|11щpt%1Ƌ1׋E苔àä11ptƉ׉1%hlƉ׉1%1Ƌ1׋EU1  11щEUƉ׉1%1Ƌ1׋EU1 1щ$ $ $EUƉ% 1lj($1щ,(,(,EUƉ%(1Ƌ,1׋x|04048<81<1x|Ɖ׉1%@DptƉ׉1%@1ƋD1׋hl1HLHL1P1щTPTPTEUƉ׉1%P1ƋT1׋EUX\X\1`1щd`d`dEUƉ%`1ljhd1щlhlhlEUƉ%h1Ƌl1׋EUptptx|x1|1EUƉ׉1%x|Ɖ׉1%1Ƌ1׋pt111щhlƉ׉1%1Ƌ1׋EU11щEUƉ%1lj1щEUƉ%1Ƌ1׋EU11EUƉ׉1%EUƉ׉1%1Ƌ1׋x|111щptƉ׉1%1Ƌ1׋hl11щEUƉ%1lj1щEUƉ%1Ƌ1׋EU11 EUƉ׉1%EUƉ׉1%1Ƌ1׋EU1  11щx|Ɖ׉1%1Ƌ1׋pt1 1щ$ $ $hlƉ% 1lj($1щ,(,(,EUƉ%(1Ƌ,1׋EU04048<81<1EUƉ׉1%@DEUƉ׉1%@1ƋD1׋EU1HLHL1P1щTPTPTEUƉ׉1%P1ƋT1׋x|X\X\1`1щd`d`dptƉ%`1ljhd1щlhlhlhlƉ%h1Ƌl1׋EUptptx|x1|1EUƉ׉1%EUƉ׉1%1Ƌ1׋EU111щEUƉ׉1%1Ƌ1׋EU11щx|Ɖ%1lj1щptƉ%1Ƌ1׋hl11 $E&ME싔hlE}vԋ(,Ɖ׉1%`dƉ׉1%1Ƌ1׋X\111щPTƉ׉1%1Ƌ1׋HL11щ@DƉ%1Ƌ1׋8<11щ04%1Ƌ1׋hl1104Ɖ׉1%(,Ɖ׉1%1Ƌ1׋`d1  11щX\Ɖ׉1%1Ƌ1׋PT1 1щ$ $ $HLƉ% 1Ƌ$1׋@D(,(,101щ404048<%01Ƌ41׋pt8<81<18<Ɖ׉1%@D04Ɖ׉1%@1ƋD1׋(,1HLHL1P1щTPTPT`dƉ׉1%P1ƋT1׋X\X\X\1`1щd`d`dPTƉ%`1Ƌd1׋HLhlhl1p1щtptpt@D%p1Ƌt1׋x|x|x1|1@DƉ׉1%8<Ɖ׉1%1Ƌ1׋04111щ(,Ɖ׉1%1Ƌ1׋`d11щX\Ɖ%1Ƌ1׋PT11щHL%1Ƌ1׋EU11HLƉ׉1%@DƉ׉1%1Ƌ1׋8<111щ04Ɖ׉1%1Ƌ1׋(,11щ`dƉ%1Ƌ1׋X\11щPT%1Ƌ1׋EU11 PTƉ׉1%HLƉ׉1%1Ƌ1׋@D1  11щ8<Ɖ׉1%1Ƌ1׋041 1щ$ $ $(,Ɖ% 1Ƌ$1׋`d(,(,101щ40404X\%01Ƌ41׋EU8<81<1X\Ɖ׉1%@DPTƉ׉1%@1ƋD1׋HL1HLHL1P1щTPTPT@DƉ׉1%P1ƋT1׋8<X\X\1`1щd`d`d04Ɖ%`1Ƌd1׋(,hlhl1p1щtptpt`d%p1Ƌt1׋EUx|x1|1`dƉ׉1%X\Ɖ׉1%1Ƌ1׋PT111щHLƉ׉1%1Ƌ1׋@D11щ8<Ɖ%1Ƌ1׋0411щ(,%1Ƌ1׋EU11 $E&ME싔(,E}vԃE}  EQU쉕UE4Ћ|EtŨ|Ŭ11MTE}vEWE쉅UE4Ћ|E싴(,11MTE}vl[^_]US48%ÙE EEEUE@u"E@D$E$Eǀ}E*EEET@QEEm}tE?vD$D$E$4}A'ED$E$bEǀm@E@}?w*EEET@QEEm}tE?vEEU҉EUEjE Eu}t` +UEЋE%E +ME‹EEUEUmE} vE Eu}t*D$ D$HD$$ '4[]U(EEED$E D$E$US$"EED$D$E$E􋐀ED@E􉐀E􋀀 vgE􋐀ED@E􉐀E􋀀?vD$D$E$E􋐀ED@E􉐀E􋀀vՋMU@E􋀀D$ L$$E􋀀P E􉐀D$D$E$E3E UEЋR1‹ET@EHUEЋR1‹ET@EHUEЋR1‹ET@EHUEЋR1҉‹ET@EHUEЋR‹ET@EHUEЋR‹ET@EHUEЋR‹ET@EHUEЋR‹ET@E}$[]UEEE@ÐUEEE#EgE@E@ܺE@ vT2E@ËE@E@XUS ÒD$@E D$E$EEE@EE@EE@ EE@EE3E3EMEED$ E$2U‰UD$ M $2EE3E3EMEED$E$2U‰UD$ M $2EE3E3EMEED$E$\2U‰UD$ M $A2EE3E3EMEED$ E$2U‰UD$ M $1EE3E3EMEED$E$1U‰UD$ M $1EE3E3EMEED$E$1U‰UD$ M $f1EE3E3EMEED$E$81U‰UD$ M $1EE3E3EMEED$ E$0U‰UD$ M $0EE3E3EMEčED$ E$0U‰UD$ M $0EE3E3EMEȍED$ E$]0U‰UD$ M $B0EE3E3EME̍ED$E$0U‰UD$ M $/EE3E3EMEЍED$E$/U‰UD$ M $/EE3E3EMEԍED$E$/U‰UD$ M $g/EE3E3EME؍ED$E$9/U‰UD$ M $/EE3E3EME܍ED$ E$.U‰UD$ M $.EE3E3EMEED$E$.U‰UD$ M $.EU#UE#E ЋMEyZED$E$R.U‰UD$ M $7.EU#UE#E ЋMEyZED$E$-U‰UD$ M $-EU#UE#E ЋME؍yZED$E$-U‰UD$ M $-EU#UE#E ЋMEyZED$ E$S-U‰UD$ M $8-EU#UE#E ЋME̍yZED$ E$,U‰UD$ M $,EU#UE#E ЋMEyZED$ E$,U‰UD$ M $,EU#UE#E ЋMEyZED$E$T,U‰UD$ M $9,EU#UE#E ЋMEyZED$E$+U‰UD$ M $+EU#UE#E ЋMEԍyZED$E$+U‰UD$ M $+EU#UE#E ЋMEyZED$ E$U+U‰UD$ M $:+EU#UE#E ЋMEȍyZED$E$+U‰UD$ M $*EU#UE#E ЋMEyZED$ E$*U‰UD$ M $*EU#UE#E ЋMEyZED$ E$V*U‰UD$ M $;*EU#UE#E ЋME܍yZED$E$*U‰UD$ M $)EU#UE#E ЋMEЍyZED$ E$)U‰UD$ M $)EU#UE#E ЋMEčyZED$ E$W)U‰UD$ M $<)EE E3EMEnED$ E$)U‰UD$ M $(EE E3EME̍nED$ E$(U‰UD$ M $(EE E3EME܍nED$E$g(U‰UD$ M $L(EE E3EMEnED$E$(U‰UD$ M $'EE E3EMEȍnED$E$'U‰UD$ M $'EE E3EMEnED$ E$w'U‰UD$ M $\'EE E3EMEčnED$ E$''U‰UD$ M $ 'EE E3EMEnED$E$&U‰UD$ M $&EE E3EMEnED$E$&U‰UD$ M $l&EE E3EMEnED$E$7&U‰UD$ M $&EE E3EMEnED$ E$%U‰UD$ M $%EE E3EMEnED$E$%U‰UD$ M $|%EE E3EME؍nED$E$G%U‰UD$ M $,%EE E3EMEЍnED$ E$$U‰UD$ M $$EE E3EMEnED$E$$U‰UD$ M $$EE E3EMEԍnED$E$W$U‰UD$ M $<$EU#UE#E ЋME-$CpED$ E$$U‰UD$ M $#EU#UE#E ЋMEȍ-$CpED$ E$#U‰UD$ M $#EU#UE#E ЋMEЍ-$CpED$E$X#U‰UD$ M $=#EU#UE#E ЋME̍-$CpED$E$#U‰UD$ M $"EU#UE#E ЋME-$CpED$E$"U‰UD$ M $"EU#UE#E ЋMEč-$CpED$E$Y"U‰UD$ M $>"EU#UE#E ЋMEԍ-$CpED$ E$"U‰UD$ M $!EU#UE#E ЋME-$CpED$E$!U‰UD$ M $!EU#UE#E ЋME؍-$CpED$ E$Z!U‰UD$ M $?!EU#UE#E ЋME-$CpED$E$!U‰UD$ M $ EU#UE#E ЋME-$CpED$E$ U‰UD$ M $ EU#UE#E ЋME-$CpED$E$[ U‰UD$ M $@ EU#UE#E ЋME܍-$CpED$E$ U‰UD$ M $EU#UE#E ЋME-$CpED$E$U‰UD$ M $EU#UE#E ЋME-$CpED$E$\U‰UD$ M $AEU#UE#E ЋME-$CpED$ E$U‰UD$ M $EE E3EME-VED$ E$U‰UD$ M $EE E3EME-VED$E$gU‰UD$ M $LEE E3EME-VED$E$U‰UD$ M $EE E3EMEȍ-VED$ E$U‰UD$ M $EE E3EME-VED$E$wU‰UD$ M $\EE E3EMEԍ-VED$E$'U‰UD$ M $ EE E3EME-VED$ E$U‰UD$ M $EE E3EME̍-VED$ E$U‰UD$ M $lEE E3EME܍-VED$E$7U‰UD$ M $EE E3EME-VED$ E$U‰UD$ M $EE E3EME-VED$ E$U‰UD$ M $|EE E3EMEč-VED$E$GU‰UD$ M $,EE E3EMEЍ-VED$ E$U‰UD$ M $EE E3EME-VED$E$U‰UD$ M $EE E3EME-VED$E$WU‰UD$ M $<EE E3EME؍-VED$E$U‰UD$ M $EEEUUMMEEUUEEE@EE@EE@ EE@EE E3EME拢PED$E$mU‰UD$ M $REE E3EME܍拢PED$ E$U‰UD$ M $EE E3EME拢PED$ E$U‰UD$ M $EE E3EME拢PED$ E$}U‰UD$ M $bEE E3EMEȍ拢PED$ E$-U‰UD$ M $EE E3EME拢PED$E$U‰UD$ M $EE E3EMEЍ拢PED$E$U‰UD$ M $rEE E3EME拢PED$E$=U‰UD$ M $"EE E3EME؍拢PED$E$U‰UD$ M $EE E3EME拢PED$E$U‰UD$ M $EE E3EME拢PED$E$MU‰UD$ M $2EE E3EMEč拢PED$ E$U‰UD$ M $EE E3EME拢PED$E$U‰UD$ M $EE E3EME̍拢PED$E$]U‰UD$ M $BEE E3EME拢PED$ E$ U‰UD$ M $EE E3EMEԍ拢PED$E$U‰UD$ M $EU#UE#E ЋME$M\ED$ E$hU‰UD$ M $MEU#UE#E ЋMEЍ$M\ED$ E$U‰UD$ M $EU#UE#E ЋME$M\ED$E$U‰UD$ M $EU#UE#E ЋME$M\ED$E$iU‰UD$ M $NEU#UE#E ЋME$M\ED$ E$U‰UD$ M $EU#UE#E ЋME؍$M\ED$E$U‰UD$ M $EU#UE#E ЋME$M\ED$ E$jU‰UD$ M $OEU#UE#E ЋME̍$M\ED$ E$U‰UD$ M $EU#UE#E ЋME܍$M\ED$E$U‰UD$ M $EU#UE#E ЋME$M\ED$E$kU‰UD$ M $PEU#UE#E ЋMEč$M\ED$ E$U‰UD$ M $EU#UE#E ЋMEԍ$M\ED$E$U‰UD$ M $EU#UE#E ЋME$M\ED$E$lU‰UD$ M $QEU#UE#E ЋMEȍ$M\ED$E$U‰UD$ M $EU#UE#E ЋME$M\ED$ E$U‰UD$ M $EU#UE#E ЋME$M\ED$ E$mU‰UD$ M $REE E3EME>pmED$ E$U‰UD$ M $EE E3EME>pmED$E$U‰UD$ M $EE E3EME>pmED$E$}U‰UD$ M $bEE E3EME>pmED$ E$-U‰UD$ M $EE E3EME>pmED$E$ U‰UD$ M $ EE E3EME܍>pmED$E$ U‰UD$ M $r EE E3EME>pmED$E$= U‰UD$ M $" EE E3EMEȍ>pmED$E$ U‰UD$ M $ EE E3EMEЍ>pmED$ E$ U‰UD$ M $ EE E3EMEč>pmED$ E$M U‰UD$ M $2 EE E3EMEԍ>pmED$E$ U‰UD$ M $ EE E3EME>pmED$E$ U‰UD$ M $ EE E3EME̍>pmED$ E$] U‰UD$ M $B EE E3EME>pmED$ E$ U‰UD$ M $ EE E3EME>pmED$E$ U‰UD$ M $ EE E3EME؍>pmED$E$m U‰UD$ M $R EU#UE#E ЋMEčvmzED$E$ U‰UD$ M $ EU#UE#E ЋMEvmzED$E$ U‰UD$ M $ EU#UE#E ЋMEvmzED$E$n U‰UD$ M $S EU#UE#E ЋMEvmzED$ E$ U‰UD$ M $EU#UE#E ЋMEvmzED$E$U‰UD$ M $EU#UE#E ЋMEЍvmzED$E$oU‰UD$ M $TEU#UE#E ЋMEvmzED$E$U‰UD$ M $EU#UE#E ЋMEvmzED$E$U‰UD$ M $EU#UE#E ЋMEvmzED$E$pU‰UD$ M $UEU#UE#E ЋMEԍvmzED$ E$U‰UD$ M $EU#UE#E ЋMEvmzED$ E$U‰UD$ M $EU#UE#E ЋME؍vmzED$ E$qU‰UD$ M $VEU#UE#E ЋMEȍvmzED$ E$U‰UD$ M $EU#UE#E ЋMEvmzED$E$U‰UD$ M $EU#UE#E ЋME̍vmzED$E$rU‰UD$ M $WEU#UE#E ЋME܍vmzED$E$U‰UD$ M $EE3E3EMEԍED$E$U‰UD$ M $EE3E3EMEED$E$U‰UD$ M $pEE3E3EME̍ED$ E$BU‰UD$ M $'EE3E3EMEED$ E$U‰UD$ M $EE3E3EMEED$ E$U‰UD$ M $EE3E3EMEED$E$gU‰UD$ M $LEE3E3EMEčED$E$U‰UD$ M $EE3E3EMEED$E$U‰UD$ M $EE3E3EMEED$E$U‰UD$ M $qEE3E3EMEED$ E$CU‰UD$ M $(EE3E3EME؍ED$E$U‰UD$ M $EE3E3EME܍ED$E$U‰UD$ M $EE3E3EMEED$E$hU‰UD$ M $MEE3E3EMEED$ E$U‰UD$ M $EE3E3EMEȍED$ E$U‰UD$ M $EE3E3EMEЍED$ E$U‰UD$ M $rEE@EEEE@EUEPE@ EUEPE@EUEP EEUEPUEĄ[]UEM EE]US$aE EEEE@X@u:ED$E$;$WE@XE@PEP}E@X$EHXEETQEPXEm}t E@X?~D$D$E$3}t~3ED$E$E@XE@PEPm@E@}?w$$EHXEETQEPXEm}t E@X?~˃$[]UE EE D$E$UEEUE@EUE@EUE@ EUE@EUS4M_EED$D$E$ E@EEEEEEEE@XEE;EsEEEeeE EE@X7=EPXEDEPXEPXEDEPXE@X7~tEPXEDEPXEPXEDEPXE@X?~D$D$E$!ED$8D$$iE‹EPPE‹EPQE‹EPRE‹EPSE‹EPTE‹EPUE‹EPVE‹EPWED$E$$EEUEEUE@EUE@EUE@ EUE@E4[]UEEEUSt]E$ED$E D$E$E$D$ED$E$t[]ÐUEEE#EgE@E@ܺE@ vT2E@ËE@E@XUVtv#EEEMUE E UE E UE E E EE EE}~EEE@EE@EE@ EE@ED$E$"‹E3E#E3E‹EEyZED$M $"ED$E$"‹E3E#E3E‹EEyZED$M $g"ED$E$Q"‹E3E#E3E‹EEyZED$M $"ED$E$"‹E3E#E3E‹EEyZED$M $!ED$E$!‹E3E#E3E‹EčEyZED$M $!ED$E$s!‹E3E#E3E‹EȍEyZED$M $?!ED$E$)!‹E3E#E3E‹E̍EyZED$M $ ED$E$ ‹E3E#E3E‹EЍEyZED$M $ ED$E$ ‹E3E#E3E‹EԍEyZED$M $a ED$E$K ‹E3E#E3E‹E؍EyZED$M $ ED$E$ ‹E3E#E3E‹E܍EyZED$M $ED$E$‹E3E#E3E‹EEyZED$M $ED$E$m‹E3E#E3E‹EEyZED$M $9ED$E$#‹E3E#E3E‹EEyZED$M $ED$E$‹E3E#E3E‹EEyZED$M $ED$E$‹E3E#E3E‹EEyZED$M $[EUE1‹E1‹E1MD$E$.‹E3E#E3E4D$M $ EEEyZED$E$EUE1‹E1‹E1MD$E$‹E3E#E3E4D$M $EEEyZED$E$kEUE1‹E1‹E1MD$E$>‹E3E#E3E4D$M $EEEyZED$E$EUE1‹E1‹E1MD$E$‹E3E#E3E4D$M $EEEyZED$E${EUċE1‹E1‹E1MD$E$N‹E3E3E4D$M $-EċEčEnED$E$EUȋE1‹E1‹E1MD$E$‹E3E3E4D$M $EȋEȍEnED$E$EŰE1‹E1‹E1MD$E$d‹E3E3E4D$M $CE̋E̍EnED$E$EUЋE1‹E1‹Eĉ1MD$E$‹E3E3E4D$M $EЋEЍEnED$E$EUԋE1‹E1‹Eȉ1MD$E$z‹E3E3E4D$M $YEԋEԍEnED$E$2EU؋E1‹E1‹Ẻ1MD$E$‹E3E3E4D$M $E؋E؍EnED$E$EU܋E1‹E1‹EЉ1MD$E$‹E3E3E4D$M $oE܋E܍EnED$E$HEUE1‹E1‹Eԉ1MD$E$‹E3E3E4D$M $EEEnED$E$EUE1‹E1‹E؉1MD$E$‹E3E3E4D$M $EEEnED$E$^EUE1‹E1‹E܉1MD$E$1‹E3E3E4D$M $EEEnED$E$EUE1‹E1‹E1MD$E$‹E3E3E4D$M $EEEnED$E$tEUE1‹E1‹E1MD$E$G‹E3E3E4D$M $&EEEnED$E$EUE1‹E1‹E1MD$E$‹E3E3E4D$M $EEEnED$E$EUE1‹E1‹E1MD$E$]‹E3E3E4D$M $<EEEnED$E$EUE1‹E1‹E1MD$E$‹E3E3E4D$M $EEEnED$E$EUE1‹E1‹E1MD$E$s‹E3E3E4D$M $REEEnED$E$+EUċE1‹E1‹E1MD$E$‹E3E3E4D$M $EċEčEnED$E$EUȋE1‹E1‹E1MD$E$‹E3E3E4D$M $hEȋEȍEnED$E$AEŰE1‹E1‹E1MD$E$‹E3E3E4D$M $E̋E̍EnED$E$EUЋE1‹E1‹Eĉ1MD$E$‹E3E3E4D$M $~EЋEЍEnED$E$WEUԋE1‹E1‹Eȉ1MD$E$*U#UE E#E Ѝ4D$M $EԋEԍE-$CpED$E$EU؋E1‹E1‹Ẻ1MD$E$U#UE E#E Ѝ4D$M $E؋E؍E-$CpED$E$]EU܋E1‹E1‹EЉ1MD$E$0U#UE E#E Ѝ4D$M $E܋E܍E-$CpED$E$EUE1‹E1‹Eԉ1MD$E$U#UE E#E Ѝ4D$M $EEE-$CpED$E$cEUE1‹E1‹E؉1MD$E$6U#UE E#E Ѝ4D$M $ EEE-$CpED$E$EUE1‹E1‹E܉1MD$E$U#UE E#E Ѝ4D$M $EEE-$CpED$E$iEUE1‹E1‹E1MD$E$<U#UE E#E Ѝ4D$M $EEE-$CpED$E$EUE1‹E1‹E1MD$E$U#UE E#E Ѝ4D$M $EEE-$CpED$E$oEUE1‹E1‹E1MD$E$BU#UE E#E Ѝ4D$M $EEE-$CpED$E$EUE1‹E1‹E1MD$E$U#UE E#E Ѝ4D$M $EEE-$CpED$E$uEUE1‹E1‹E1MD$E$HU#UE E#E Ѝ4D$M $EEE-$CpED$E$ EUE1‹E1‹E1MD$E$ U#UE E#E Ѝ4D$M $ EEE-$CpED$E${ EUċE1‹E1‹E1MD$E$N U#UE E#E Ѝ4D$M $% EċEčE-$CpED$E$ EUȋE1‹E1‹E1MD$E$ U#UE E#E Ѝ4D$M $ EȋEȍE-$CpED$E$ EŰE1‹E1‹E1MD$E$T U#UE E#E Ѝ4D$M $+ E̋E̍E-$CpED$E$ EUЋE1‹E1‹Eĉ1MD$E$ U#UE E#E Ѝ4D$M $ EЋEЍE-$CpED$E$ EUԋE1‹E1‹Eȉ1MD$E$Z U#UE E#E Ѝ4D$M $1 EԋEԍE-$CpED$E$ EU؋E1‹E1‹Ẻ1MD$E$ U#UE E#E Ѝ4D$M $ E؋E؍E-$CpED$E$ EU܋E1‹E1‹EЉ1MD$E$` U#UE E#E Ѝ4D$M $7 E܋E܍E-$CpED$E$ EUE1‹E1‹Eԉ1MD$E$ U#UE E#E Ѝ4D$M $ EEE-$CpED$E$ EUE1‹E1‹E؉1MD$E$f ‹E3E3E4D$M $E EEE-*>5ED$E$ EUE1‹E1‹E܉1MD$E$‹E3E3E4D$M $EEE-*>5ED$E$EUE1‹E1‹E1MD$E$|‹E3E3E4D$M $[EEE-*>5ED$E$4EUE1‹E1‹E1MD$E$‹E3E3E4D$M $EEE-*>5ED$E$EUE1‹E1‹E1MD$E$‹E3E3E4D$M $qEEE-*>5ED$E$JEUE1‹E1‹E1MD$E$‹E3E3E4D$M $EEE-*>5ED$E$EUE1‹E1‹E1MD$E$‹E3E3E4D$M $EEE-*>5ED$E$`EUE1‹E1‹E1MD$E$3‹E3E3E4D$M $EEE-*>5ED$E$EUċE1‹E1‹E1MD$E$‹E3E3E4D$M $EċEčE-*>5ED$E$vEUȋE1‹E1‹E1MD$E$I‹E3E3E4D$M $(EȋEȍE-*>5ED$E$EŰE1‹E1‹E1MD$E$‹E3E3E4D$M $E̋E̍E-*>5ED$E$EUЋE1‹E1‹Eĉ1MD$E$_‹E3E3E4D$M $>EЋEЍE-*>5ED$E$EUԋE1‹E1‹Eȉ1MD$E$‹E3E3E4D$M $EԋEԍE-*>5ED$E$EU؋E1‹E1‹Ẻ1MD$E$u‹E3E3E4D$M $TE؋E؍E-*>5ED$E$-EU܋E1‹E1‹EЉ1MD$E$‹E3E3E4D$M $E܋E܍E-*>5ED$E$EUE1‹E1‹Eԉ1MD$E$‹E3E3E4D$M $jEEE-*>5ED$E$CEUE1‹E1‹E؉1MD$E$‹E3E3E4D$M $EEE-*>5ED$E$EUE1‹E1‹E܉1MD$E$‹E3E3E4D$M $EEE-*>5ED$E$YEUE1‹E1‹E1MD$E$,‹E3E3E4D$M $ EEE-*>5ED$E$EUE1‹E1‹E1MD$E$‹E3E3E4D$M $EEE-*>5ED$E$oEEMEE@MEPE@MEPE@ MEP E@MEPm}t^]UEM EE]US$1ü8E EEEE@X@uBED$D$E$$hE@XE@PEP}E@Xt\$EHXEETQEPXEm}t E@X?~D$D$E$/}EE}tFED$ED$E$XE@XE@UEPE)EEE$h$EHXEETQEPXEm}t E@X?~˃$[]US4C7EED$D$E$TE@EEEEEEEE@XEE;EsEEEeeE EE@X7=EPXEDEPXEPXEDEPXE@X7~tEPXEDEPXEPXEDEPXE@X?~D$D$E$iED$8D$$_E‹EPPE‹EPQE‹EPRE‹EPSE‹EPTE‹EPUE‹EPVE‹EPWED$D$E$$hEEE‹EEE‹EEE‹EEE‹EEE@‹EEE@‹EEE@‹EEE@‹EEE@‹EEE@‹EEE@‹EEE@‹EEE@ ‹EEE@ ‹EEE@ ‹EEE@ ‹EEE@‹EEE@‹EEE@‹EEE@‹EE4[]UEEEUStI3E$ED$E D$E$E$PD$ED$E$输t[]US4p3dED$qD$D$ D$D$$~E}}ED$D$D$ 8D$D$$m~E}uQED$D$D$ D$D$$%~E}u E1} t$ED$ ED$D$ $E E2E4[]UEtED$E $EEEÐU2EXUE \U]USO1XUt-XU\UED$ED$ E D$ED$$у[]USË1-t E$\. E$m[]USǼR1F-t/Z[]US蚼%1-u[]USt0,u[]USN0,u E$[]US"í0,t EE$EE[]USr0f,t .EEE[]US豻<00,t EED$E D$E$EE[]USh/+tED$E D$E$l.ED$E D$E$Z[]US$Þ/E$-EE D$ED$E$rE$[]US$Ѻ\/E$&EE D$ED$E$0E$[]UED$E D$E$USn.*u E$ []USB.*u[]USç.*u[]USÁ.u*tE D$E$o-E D$E$[]US诹:..*tE$0EEE[]US$t-)tAE$D$E D$ED$ED$ED$ ED$E D$E$1EE<E$[]USÓ-)tED$E D$E$2EE<E[]US迸J->)t E$3[]ÐUS$葸-hUurǃhU`U$EE}tE$lD$$dU$EE}tE$8D$$貼$[]US$È,`U$FE}tE$D$$fǃU$[]US$觷2,ǃU`U$FE}tE$茊D$$$[]USQ+8UUtD$$ED$$EE􉃬UUtD$$ZED$$EEU9UUuǃUUU[]U}uUWVS\D*1t !E 1E܋VE؋VVVV VE$VE䋃 VE苃VE싃VEE܉D$0E؉D$,T$(L$$t$ |$ED$ED$ED$ED$ ED$D$X4$袹\[^_]Uû)ǁU]U詻)ǁU]U]U]US%ð)Uu Ut EEE[]US$l)}u E#}d~ Ed }yE}u$-E|} t}  EgEEMX} XFE EVUtD$ED$E$>EEE)E } uEE$[]UED$$U} tEE MEEUS$迳J(WUt }vEe}v VE VVVVE VVVEE8X} XFE EED$ED$E$0 E)E EE} uR$[]US{'EXE䋃Uu*D$ D$gD$$舶E$7EXEED$D$E$?UD$,ED$$"ED$E$D$ED$E$lUt>U9Eu3E$EMEEEpU0ЈE}~֋EEED$ED$E$肆EET;Es"EUD$,D$$S>EEE&E;ErEEEUEEE}?~ԋED$E$D$ED$E$E}=U9Eu'D$XED$pU$PǃlU$Ĕ[]US述J%Ut D$D$$*E$U[]UVS@k$ED$D$E$}fEfÊ tL t@贂$ƍ$‰t$E D$$E}~ $ޯ‹E D$$ӳEEEE܉D$D$ D$D$$} EED$D$E$hEEԃ@[^]UWVS&ñ#Uu*(D$ D$D$$ɲUuDž =UD$$蔁E}u%VuǃUDž }uD+$葁ƋU7$脮t$|$$zDž UD$D$E$tE$调Dž tED$E$tO薀$ƋUL$t$|$$E$KDž E%=t:Ud$袭t$$蜱E$Dž Eu:$g$eE$˂ǃUDž E=Xt0$#$!E$臂Dž KD$XP$謠$誤ǃU$5vnsƉ$#sE$|EEEEE0bvP$d$݃݃],E‹EEm}uƋE D$ED$E$E$&0[^]US4ʟUbdU$b.E}tE$rD$$.rE싃U$0uEEEE쉃UUED$ED$E$sED$ED$E$sUD$D$$]ǃU4UE9t'UD$D$$&E쉃UEEXD$UD$U$;} FE EED$UD$E$+sE)E EE} udU$-E}tE$GqD$$4[]ÐUS$ Ô,VtHǃ,V(V$o+E}tE$pD$($^ǃDV$[]US$蟝*(V$<,E}tE$pD$L$ǃDV$[]US$IǃDV(V${,E}tE$.pD$p$訡$[]UEE@*E@!E@2]USӜ^E<u!E@<*uE@!EEPE$EPELEE;\|ыL;T}t*9D$ D$HD$]$)N|t` Dž E`|D$$=EETE$ETELEE;`|ыE;E}ED$E$|>E@LE$ELEXEE;d|ыdhpt|t`$ Dž$$U`‹|D$$<EEED$D$0$P4uE @t Dž( Dž((E\E؋EPEEEEEMEE+EEPh$hD$LD$E܉$R-}u#hEED$$;EAh;E~4D$E$#<hEED$$;EED$ hD$LD$E܉$.hEE;`~J`U܋`D$TD$ED$ E܉D$D$$`ELEE܉LEE܋EhEd5dD$XD$ hD$LD$E܉$c7=0D$dD$XD$ hD$LD$E܉$2dhEE;`~J`U܋`D$TD$ED$ E܉D$D$$`ELEE܉LEE܋Ehem}m}xEPEE у}t^UEHT$ hD$LD$ $[EE@L}trhLEhRE@;LtDE$EPE‹ELEE;h|ыE@Lh;`|V`L`D$TD$hD$ LD$D$$9`h}tNED$ hD$LD$L$Z#Lhuhhԍ0$4}h}t)ED$ `D$TD$T$MZhD$LD$ `D$TD$L$`hlt#LhuhhԋE@;Lt*9D$ D$6HD$h$3GUhBUtB}tED$E$k7}tED$E$S7}tED$E$;7}tED$E$#7}tD$E$ 7$[]ÐUS$B8EUE)ЉEE E*eUEET$$tMm}yЋE$[]UVS0DB϶EEEE u}u*uD$ D$PD$$EEE E$TEE;E~EEEEEE}uˋE;Et*uD$ D$XD$$WE}u*uD$ D$YD$$'E} ~*uD$ D$ZD$$DMܸD$$YEE@$3ED$E$t<EED$ ED$ED$E$2ED$ ED$E܉D$E$E}xMܸ;E*uD$ D$gD$$%DEE}u$=‹EEMEtoEEu$EuEE $7;EE EE0EEED$ L$t$$EE;ErEEuEu$1EEED$ T$ED$E$EE;EOE$4EEE$4EMܸ;EًE$T0[^]ÐU$E@EEEKEEEE)E;E uE E%E$EE}~уEE@;EEEUS$<>DzE%EE@EEEEEEEE;E }u E EEH}uU0E ЉE0}uUE ЉEUE ЉEE@;E UEPEUE)EE}]EE;E0$[]UEEBEPEt$EPEEEEEEE EE@;EwEÐUS4}tE$UE E$%E$- EȋEȃT[]UED$$ UE D$E$U} tEE MEEUStB/ͣE$诵E}uEEEEE}EE@t$?;ED$ED$E$~Eă}u jEYEtEyEEE} t'E;EvEĉ$C$BE } t8E Ẽ}t EEUEȉ)ȉD$EĉD$Ẻ$Eĉ$aCUEE}EE} tE;Ev$B(Ev} tTD$ED$E$eEЃ}u QE@ED$EЉD$E $IEЉ$BUEE}EEE@t$-E} tE;Ev$BaE} tuE E؋E‹E؈U؃ED$ED$E$Eԃ}u lE[EU؃D$EԉD$$aEԉ$AEPEE}GEE@t$?ED$ED$E$E܃}u EEtEyEEE} t*E;EvE܉$ A$BEm} tyE EE‹EEE‹EEE‹EEE‹EE}t EEUE)ȉD$E܉D$E$E܉$@EPEE}EED$ED$E$E}u EEt EyE} tCEE‹E@;EvE$?$BE#} E EE@t E-E}tE0EE0EElEEEE w E0E E7EEUEe} w E0EE7EEMEEUE9rEEUE )ȉ‹E$EE‹E@PEE$>E$-EEt[]USF)ѝ$[]UED$$US4)ÑE ED$ED$ D$D$E$E}t EE}tE@ 4uE$ %s %s Libgcrypt error: invalid state transition %s => %sLibgcrypt notice: state transition %s => %s#DLibgcrypt terminated the application/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqrb_gcry_ath_mutex_destroyath.c*lock == ((ath_mutex_t) 0)_gcry_ath_mutex_lock_gcry_ath_mutex_unlock*lock == ((ath_mutex_t) 1)dummy_encrypt_blockcipher.cdummy_decrypt_blockdummy_encrypt_streamdummy_decrypt_streamcipher_register_defaultoid.OID.?cipher %d w/o key length cipher %d not found cipher %d w/o blocksize ,0,0,0,Y,0,0,gcry_cipher_close: already closed/invalid handlecipher_setivWARNING: cipher_setiv: ivlen=%u blklen=%u IV length does not match blocklengthcipher_encryptcipher mode NONE usedcipher_encrypt: invalid mode %d IECDEDEDDcipher_decryptcipher_decrypt: invalid mode %d HAGHGuH+HPH_gcry_cipher_ctln <= h->cipher->blocksizeNKK%LLNNNNNNNLNNNNNNNNNNNNNNNNNNNNNNNNNNNN5LLMNNNNNNNNNNNNNNNNN~MMalgorithm disabledalgorithm not foundno selftest availablemodulecipherdummy_generateusing dummy public key functionpubkey.cdummy_check_secret_keydummy_encryptdummy_decryptdummy_signdummy_verifydummy_get_nbitspk_register_default?pubkey_encrypt: algo=%d pkey: data: encr:pubkey_decrypt: algo=%d skey: plain:pubkey_sign: algo=%d sig:pubkey_verify: algo=%d hash:RSAnedpqusexp_elements_extract_eccidx >= 6curveprivate-keypublic-keyecdsaeccsig-valflagsenc-valrawpkcs1no-blindingsha1md5sha256ripemd160rmd160sha384sha512sha224md2md4tigerhavalsexp_data_to_mpidatahashvaluei > 0n == nframei > 1_gcry_pk_encryptmodule(enc-val(%m)))_gcry_pk_decrypt(value %m)%m_gcry_pk_sign(sig-val(_gcry_pk_genkeygenkeyrsa-use-enbits(key-data(public-key((private-key(%S(misc-key-info(pm1-factors)p - string < neededprotected-private-keyshadowed-private-key(1:%c%u:ÚǛߛalgorithm disabledalgorithm not foundno selftest availablepubkeyno-blindingprivate-keypublic-keyrsa-use-e(%s((%s %%m))failed to dump data set: %s%s%s: %s _gcry_ac_io_init_vaac.c(mode == GCRY_AC_IO_READABLE) || (mode == GCRY_AC_IO_WRITABLE)(type == GCRY_AC_IO_STRING) || (type == GCRY_AC_IO_STRING)_gcry_ac_io_writeac_io->mode == GCRY_AC_IO_WRITABLE_gcry_ac_io_readac_io->mode == GCRY_AC_IO_READABLE(flags (%s%m)(genkey(%s(nbits%d)))valuedataenc-valsig-valmd_register_defaultmd.coid.OID.?md_enable: algorithm %d not available MD5 usedmd_copyahd->bufsize == (n - sizeof (struct gcry_md_handle) + 1)! ahd->bufposunknownmd_writeprepare_macpadskeylen <= hd->ctx->macpads_Bsizemd_readmore than one algorithm in md_read(0) _gcry_md_getunimplemented function calledgcry_md_open failed for algo %d: %smd_get_algopossible usage errorWARNING: more than one algorithm in md_get_algo() no ASN.1 OID for md algo %d Oops: md debug already started dbgmd-%05d.%.10swmd debug: can't open %s algorithm disabledalgorithm not foundno selftest availablemoduledigestinvalid tests datagcry_md_open failedgcry_md_setkey failedgcry_md_read faileddoes not matchFIPS-198a, A.1OL֋ ]@< Sample #1FIPS-198a, A.2 "@_=OX0s}\]$Sample #2FIPS-198a, A.3\|ѣSample #3FIPS-198a, A.4hB u$2u*&Sample #4hmacdata-28 key-4what do ya want for nothing?Jefedata-9 key-20Hi There data-50 key-20data-50 key-26 data-54 key-131Test Using Larger Than Block-Size Key - Hash Key Firstdata-152 key-131This is a test using a larger than block-size key and a larger than block-size data. The key needs to be hashed before being used by the HMAC algorithm._gcry_hmac256_new failed_gcry_hmac256_finalize faileddoes not match in second implementation$$$$$$$ algorithm not availablemoduleget_pool_primeprimegen.cnbits == _gcry_mpi_get_nbits ((prime))primegengen prime: pbits=%u qbits=%u fbits=%u/%u n=%d prime : factor q: factor q0: factor pi: bit sizes: prime=%u, q=%u, q0=%u, p%d=%uchecking g: can't generate a prime with less than %d bits overflow in prime generation is_prime_gcry_mpi_cmp ((x),(nminus1)) < 0 && _gcry_mpi_cmp_ui ((x),(1)) > 0m_out_of_n_gcry_generate_fips186_3_primeqbits/8 <= sizeof digest_gcry_md_get_algo_dlen (hashalgo) == qbits/8seedlen <= sizeof seed_help_bufferfips186-3 pbits p=%u q=%u counter=%d fips186-3 seed:fips186-3 prime pfips186-3 prime qdigest size does not match expected sizegcry_md_open failedinvalid DATAMODEdigest mismatchARCFOUR selftest failed (%s) 8)Arcfour encryption test 1 failed.Arcfour decryption test 1 failed.ARCFOUR 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gyabcdefghijklmnopqrstuvwxyz2NBlowfish selftest failed (1).Blowfish selftest failed (2).Blowfish selftest failed (3).Blowfish selftest failed (4).BLOWFISH%s @0 /kz%?/?!M@`Iɟ'Կ@uИcnafŽ"o;h(Yy#P_w@CV/|-ҢɡHl4ma/T"2*kT:V"AӢ@f/9/Mҹ-?JDvR7,YQoz Zh{.T"5Y/mKdPIf-徐"3;䎴]4K@E?1.eUʱծ-mԢP @"8On ׿r[O/LVSTIiFXEŅc]ՊSW9j7=T*_}x:vbj Bz)^'rgP8ƌDŽZ*'JkѢ*V`C u\B&Ʉq-ls5&5 M{n0f&%HVV^c ϲc|E pPr(pH# yM;-AB G&LjMG\^ |Y#јr8S#/nqFnEV 9q +A|iCHy}B{BIZݿe\ [ ~iC?9zaz UQry吝5rNcZպ60ę _}֡{/6Y DYD̃Aѱ* ;{ B[A%zzӤ0XޘN?wiy{$[Ĭ%5P_aT1bcKU !h]Yfsc=4·~!+g\ab906;Wd/`:5F- 'zy㠌l0^7%oo;j tE'4:NiOM>dY58EfCr3c%N? (Υ'R¦սTUdpfM w&ۄgC!`X0TroSUGڿ]bVhkʃ;n-Ӧ\= wL3{9+^S_aodC x^c"&gI{ڷ"%-U^7rRyL H[k0 cq/޹ S E!5(T<)c)A|-nRPf4,0P1`sY&D\dwR3A+ٺ|o!PaH?ek«dv&4{^% ;MM1$~I,;jx`]sVz\/1Co0TyXR^/2zj0>՚1B°I #ڸ(0q_`ɣaM/Ǚ."płNؼ40y;'ƸaiH?;(ZC/v7ܱӧßn>ƼB7Q(heRwj-K'5.n\ )^XOX{iT̨g&H`K`8# ~8lI `s5GƱVL>#8d^BFzk Od^AE#\;]>rC|m~ll9`qpsv#E@]%=`GK6DήPQH<p}}d^(O= &g.yr?U+HԼ?^!@WNFRWs3NɷdŸW1O g_?@k{C=K۵cUȗn-J(JqoCCl< _P/~׿PZG.Q>pX.0_|r *,]I鎸P'WIoyR}}Yr@EEt]>uOiVA#. '`vteyvvwHNma}/ 4H<0(Ow Vܒ M"7)}V'|@|硴f^aÝ <є`AFv\;x,WGl"}NC~8<=Q8d{h'فI]j~vh]9K9 ;#Im<Eub'z\aBΒ~Brrp }ȡ[(Ob<51)BSjO[}m(Ki\j#MŌ?,-ҖXRg[HJI \EkӉ7`:SRqDIK @sg4|~q6UO/Т`?mPьGnU?墼38Wg} =3{r3O̫]ňv{{uWBdBc+ri/n+_mazgaq%9̸L!gуb>ܷν8\ =Dmn`I:T`H'W+8$ ږ%Eh;}E `P/(b4 ٠m+1+dZ0RXBA\1>26F3S75 {s{OJWdCQz(~c5_ yCdcdJ$_(͸O@C " 0 O7-{$MgQLq_-_d !S^>'_aB%rqK=;&o~~TLmDl߫I&Ǡ36~?Pa w8Pr.PwWFgOT3ɏ1 i5M\=fȦ[]oڑo/"F}F9mOCCN!и  ?X(>nH&p׋wt|% - y#;(8itb߷@!{7Ȋ@ YVvO@/{U MVi35'#WȯVeka^u˅nwU2?-ɿ[%;з$;mc fÀ(82 Tɪס2Zb,gTzuw11&o6F HjyZVLj~CRv/ t,t* M|k .TA5B=!&|,aRe1i%& !\1cr ^Iy p1 d>>̶Ոî 0rlqn/kءDVÈ9/ű1(x⤣2}o~X$Ū{s0a!-!)۳*)e\,0?Б\,ԩT _w:^VxV޾\!uQųåҶw#)Ei/z毲p[v F98/gsD)k)/Ifingӛ/~p%Q^$Slj>!DYܷ)eyCy9A+MWN )zkS< ~U3rŅ?~  ~tn,fy3jXDD1Zs"*ˁc8:$zi HIĀ@8HުL H_%A@N$A UeQr% 9jyMc@hV 틕Z Vqק)N-fcqw*7 5Wa"ɠBր[t!h!hl iwW~@PճMװx QV$AV ʔUWnྵa$ XK'aU{whkldMDfd~i/IO70j5,s@IvM;B(HDLns) _ɋ}oaOw.+rץ<}+FYYEEهTNoHm| ǥcs_DVj͈prͳ]ny` E`1©\1BN"r\,rN@%/N2g@#x\n܃"ukMxnXO DH?{vw#Vu*F_( +8=6 JRft;QZylu eX&hJpFS(l\v0k)h76*g$ k%ֿh,DUueI40" WIbuU~bڨv^FESGml,gHL|3ەCh\SU2` ߝWc9^28aI37~^b<#NygCHKJf-ۄoH Ja)Yfc(` 0qt&@3/C~A^ l( ؒ0~of˜os*`ژ46K-%#= %IH6Jo8C@TzWOpA:Z„TU|5YŗZ:G:%Sj~=eI&TwQ[P]vlDȨ!帊iX`[ŗY)L;]J5ULkD$5鰽bעT/I18T(q)9H[/u@g+3-fVo*ɛ`( ')dMP˲,\26K_A !PNhذy\CPIMAC8wn\e0Rԋ@+>`xT7}02m-yyS"wuXȃoxkcZ\3]ùzv٣Byqj3ƚ`'PC=+mvN%ύHf6AN( aϩI=߹_d: }+p?PO+Zbbyj.H@,Z@"ғ-ES4n)olIIBr~V>olbfLTq*+9)XLVRf.S9v.i硦>iFt+LVvuOx39]O#2]2=&K/~~<O^?vf)o=E4ӷ+4grN=U"g`k8=ü0}8QcÐӝXyTGָaYwSW-XVcNx.F~eyUڑ0@5㶼P?!@=LXI6QpӱڍyKoqK 0ݻ맕d5w$,ϩ/ tцB*v:-7ޚ, )p@ :$7ѴyN] h1 HZ޻Bf1畏?r 3uQB}\cmd!@ WS1zݨ]3CoFq"8ԚέiGb[UgfN G[oLĎnrWxzdD]Ջ` l_9 ]c2֋~ pIPӻߘ)* mS~H~X.t;/RG'~[!<8zvOB9`55'{ɸ6g {pqT3^-ZId, =4pBwbO&Ҹ$d%FN`7>͕xE_{ ۫v"{.1ן%$r_m L=mPO%os#(ĴyI%4aĘnzn|l6AT޾'VAJJ{` ,8I%vK$%Gv XY f 0NndQ& #Phꃢ12CAST5 selftest failed (%s). CAST5%s 1dUZR8IgL&18IgL&18IgL&1QEKX-D qxn*CCCBD0YW7B@#Eg#Eg#Egsomedata=O#EgUUUUUUUU#Egsomedata#EgUUUUUUUUܺvT2somedataHcbrRg fY!dj4Wsquiggle}*f0[~r)tF4 b2[DES maintenance test failed.Triple-DES test failed.Triple-DES SSLeay test failed on encryption.Triple-DES SSLeay test failed on decryption.SHA1 not availableweak key table defectDES weak key detection failedlow-levelcipherDES1.2.840.113549.3.71.3.36.3.1.3.2.11.2.840.113549.1.12.1.33DESc|w{ko0g+׫vʂ}YGԢr&6?4q1#'u ,nZR;ֳ)/S [j˾9JLXCM3EPfHa5WiَU(ߌ BhA-Tcc||ww{{ kkooT`00PggV++}bMvvE@}}YYGG Ag_E#Srr[u=L&&jl66Z~??AOh44\Q4qqsb11S*? RF##e^0(7 / $6=&N''iuu X,,t4.6-nnZZ[RRv;;Ma}R)){>^//qSSh,@ `yȶ[[jjFgr99KJJޘLL԰XXJk*OCCŚMMf33UEEPPx<!KKa pp|>>BqffHHaaj55_WWiX:''8+"3iip3-<" IUUP((xzY  e1BBhhAA)Z--w{˨TTm,:cc||ww{{ kkooTP`00gg}V++bMvvEʝ@ɇ}}YYɎGG Ag_E#Srr[u=jL&&Zl66A~??O\h44Q4qqsSb11?* ReF##^(07 / 6$=&iN''uu tX,,.4-6nnZZ[RRMv;;a}{R))>q^//SSh,`@ y[[jjFgKr99ޔJJԘLLXXJk*OņCCךMMUf33ϊEEPPDx<<%KQQ]@@?!Hp88cwucB!!0 mL 5&/__5̈DD9.WU~~Gz==dd]]+2ss``ўOOfD""~T**; ʌFF)k<(y^^ v;Vd22Nt:: ےII lH$$\\]nCbb917yy2CYn77mmdҜNNIllVV%eezzGoxxoJ%%r\..$8WsQ#|ݜtt!>ݖKKa ppB|>>qffؐHHaa_j55WWiX':'8+3"iipى3-"< IUUxP((zߏY  e1ƄBBhhÂAA)wZ--{TTm:,cc||ww{{ kkooT0P`0gg+}V+b׫MvvEʂ@}}YYGɎG AgԢ_E#Srr[u=&jL&6Zl6?A~?O4\h4Q4qqs1Sb1?* R#eF#^(07 / 6$=&'iN'uu  ,tX,.4-6nnZZ[RR;Mv;aֳ}){R)>/q^/SSh, `@ y[[jjF˾g9Kr9JޔJLԘLXXJk*OCņCMךM3Uf3EϊEPPKݖKa pp>B|>qffHؐHaa5_j5WWiX':'8+3"iipَ3-"< IUU(xP(zߌY  e1BƄBhhAÂA)-wZ-{TTm:,cc||ww{{ kkooT00P`gg++}VbMvvE@}}YYGGɎ Ag_E#Srr[uᓓ=&&jL66Zl??A~O44\hQ4qqs11Sb?* R##eF^(07 / 6$=&''iNuu ,,tX.4-6nnZZ[RR;;Mva})){R>//q^SSh, `@㱱y[[jjFg99KrJJޔLLԘXXJk*ŪOCCņMMך33UfEEϊPP<KKݖa pp>>B|qffHHؐaa55_jWWiX':'8똘+3"iip3-"< IUU((xPzY e1BBƄhhAAÂ)--wZ{TTm:,QP~AeS:'^;kEXK 0UvmvL%O*&5DbޱZI%gE]/uLFk_mzRYԾ-Xt!Ii)Du‰jyxX>k'qݾO f}:cJ1Q3`bSEdwk+pHhXElR{s#rKWfU*(/{70(#j\+yNie4bĦ4.SU2u 9@`^qnQ>!=>MFTq]o`P$ֽ闉@CgٞwB[8yۡ| G|B 2+HplZrN8V=6-9' dh\![T$6.: gWOa ZwKi⓺ *<"C ǭ-WuLݻ`&\rDf;[~4C)v#ܶhc1Bc"@ J$}һ=2)m/Kܲ0 Rw+lpHGd"Ġ?V},"3IN8ʢ 6ϥz(ڷ&?,:Px j_̛T~Fbظ.9^ï]iГ|o-%Ȭ;}cn;{&x nY욷One~!Jo6 )|1*?#1ƥ05ftN7ʦа3JAP/vM֍CM̪MTߞѵLj,FeQ^5]ts A.gZRV3mGa7 zY<Ω'a5zG8$4,£@_r% ('qOf }:cJ1`Q3EbSdwk+XpHhElR{#srKW*fU(/š{70(#j\+yNie4bĦ4.SU2u9 @`^qQn>!=>FM潵Tq]o`P$ֽ̉@CwgٞB8[yG| |B H2+pNlZrV8='6-9d !h\ћ[T:$6. gWҴOŢa iZwK ⓺*C<"  ǹ-WLu`&\rDf;4[~vC)#hc1Bc@" }J$һ=2m)K/ܲ0 Rwl+pH"GdĨ?V},"3LJIN8ʢ6 Ϧ(z&ڷ?,: Pxj_bT~Fظ^.9ï]|iГo-%;Ȭ}nc{; &xnY욷Oen~!ٺJo6 )|11*?#0ƥ5f7tNʰ3JAP/vMMCT̪MѵLj,FeQ^]5st. AZgR3VmGaz7 Y<Ω'5ah,8$4_£@r %(kXq'Of :}Jc13`QEbSwdk+hXpHElR{#srKW*fU(/{70(#j\+ϴyNieھb4ĦS4.U2u9 @`^qQn>!=>FM捵T]qo`P$ֽC̉@wgB苈[8y G||B H2+prNlZ8V=9'6-d !h\Tћ[.:$6g WҴO aKiZw *C<"  ǭ򋨹-WLuݻ`&\r;Df~4[)vC#hc1Bc"@ $}J=һ2m)/K0ܲR wl+pHd"GĨ?,V}"3NLJI8 6ԁϦ(z&ڷ?,: Px̛j_FbT~^.9À]|i-o%;Ȭ}cn蜻{;x &nY욚One~!ٺ6Jo |)1#1*?0ƥf57tNʦа3JAP/֍vMMCMT̪䖵шLj,QFe^5]tsA. ZgRV3Gma z7Y<'Ω5ah4,8$@_£r% I(kq'O f:}Jc1Q3`SEbdwk+HhXpEl{Rs#KrWU*f(/{7(0#j\+yiNe4bѦ.S4U2u9 `@q^nQ!>=>FMT]qoP`$@C̉ٞwgB[8y| GB| +H2pZrNl8V=-9'6d \!h[Tћ6.:$ g WҴO awKiZ *"C< ǭ򶨹-WuLݻ`&r\f;D~4[C)v#hc1cB"@ J$}=2)mǞ/K0܆R wl+pHd"GĨ?},V3"INLJ8ʢ 6Ϧz(&ڭ?:,x P_̛j~FbTظ9^.ï]Г|i-o%Ϭ;}cn;{&x YnOne~!ٺo6J |)1?#1*0Ƣf5N7tʦа3JAP/M֍vMCMT̖ѵjL,eQF^5]ts A.gZRV3Gma z7Y<'a5G$4,8@_r% Ky xZݨ31Y'_`QJ -zɜ;M*W^EL;k5f'q)|_ REHKEWYs7}:o-a vm`dwmzRYڛ[Tщ@ĊIN>7,%1<+&MFCMQP_[u‰j{˄aiГ|gٞw=3!/2 9$/vM֍xDۆj_̛dVNi@`R{\r >!0("3,:= 6+ 2?(% necntsyxޱZIиWB£@_̪MTAO]Sywek1?-# | GuLnQgZX>kQ3`J$}C)v4b=o&x /uV3[8L% A.al{vUXOB һ=ܲ0Ω'*zGhW^EL;k5f'q)|_ REHKEWYs7}:o-a vm`dwmzڕRYћ[T̉@CLJIN>7,%1<+&FMMCPQ[_ju‰a{˄|iГwgٞ=3!/29 $/vMֆxDۛj_̐dVNi@`R{\r >!0("3,:=6 + 2?( %enncstxyIޱZBиW_£@T̪MAO]Sywek1?-# G| LuQnZgkX>`Q3}J$vC)4b=o &x/u3V8[%L. Aal{vUXOB һ=ܲ0Ω'*hW^ELk;f5q'|)_R EHKEWY7s:}-o amv`wdzmYڕRTћ[C̉@NLJI>7,%1<+&FMMCPQ[_ju„a{˓|iОwg=3!/29 $/֍vMۆxD̛j_dVNi@`R{\r >!0("3,:= 6+ 2?(% necntsyxZIޱWBи@_£MT̪AO]SywekӲ1?-#  G|LuQnZg>kX3`Q$}J)vCb4o=x &u/V3[8L%A. al{vUXOB =һ0ܲ'Ω*W^ELk;f5q'|)_R EHKEWY7s:}-o avm`dwmzRYڕ[Tћ@C̉INLJ>7,%1<+&FMMCPQ[_‰ju˄a{Г|iٞwg=3!/29 $/M֍vDۆx_̛jVdiN`@{Rr\ !>(03":,= 6+ 2?(% necntsyxZI޸WBУ@_ªMTAO]Sywek1?-# | GuLnQgZX>kQ3`J$}C)v4b=o&x /uV3[8L% A.al{vUXOB =Ҳ0ܩ'Π*Gid*/zKZ(?)3&_v*I!9ͭ1#N-HOex\XWgdcB3||&_==סv*Ia!s?ٵmmŮxx9mřͤvv>>1gˋG[#``ݰjjMMN-|UUHZ~~O!!ze&^^xfZZ\KeeXNbbE@@W33g^d}OOjc/ttu \\t<3--00I..IIhrFFDUwwبMC((i))y.JY BBnG//49##5bj녅"ɡqq𐐛SዋNNo>oo TRۻ{/ii99 a#PDllF''%vІPPVU Q%zz99٩gqRRevEEKKࠀZZfxjjcc**68T Cb5$AAwl((C2u{{7& pDD~~ZHzжG$$<0祄kkAT``#E::[h=Y!ff1oo>WWc[M.mmكQS]]c|hh;?00֥zz%  5㧧#a鯌:\\ s11',v%VV {Nk44SjÙ[[GGk""ȽEnⳳtt/fXXV +^^,,µIIϕ~}} d wm9j||3qqb7q=yQ >>ܭ??-$vvUU@@xx%%͹MwwUD PP077ӡ@aa4NNTTlpss*;;Rҟ A{؈Og1''Fgg'88( HHx`.LLeeK\++DZoBB RJJ==_Y :Ia|-!!OBrr;//GH,mF<)iOO}d*..Iii/\^zчddե&&K`Z66"(uu?y)--3B|3|&=_=סv䔁*Ias!ė?mmxxm9vv>>g1G[`#`jjMMN|-ޝUUZ~H~!O!z&e^^fZxZKe\eNbXbE@@3W3g^}OdOjc/ttu \\t3-<-00I..IIrFhFUwDwبM(C()iy)ّ.ѬJYּ֨ BBn/G/9#4#b5j܅"qqSԋNNo>ooT R{i/i99 #aôDlPlF''v%PPVUQ %zz٩9ِgqqReevEKfxZfݰjc68*6T TC Cb5b$$wlAwC(2u27{ԛ&p pDZH~ZzzЌGG<0$o>Wc[[MM.mQSSc|]c;h;??֥0%z% 55#a#鯀:\s ',1'v%v V{{NkS4jęÙ[GkkȽ"Enn/t/f̙XVԋ ++^µ,‰I~~ } ddw m9mjj3|ѡqb7q7=y=Q Qܭ>-$?-vU؂@x͹%MUDwU  P00ӡ7@@4a4NlpTl*s*R;R A {؈OOg1gF'F'g( 8(x`Hx..LK\eKDZ+oo B RJ_=YY ::Iaa|-|O!BB;r۸G/HH,m,FW)i)}dO}*I.I/i\\^^zЇчdK&``Z"(6"?uy)y3<-3_Ly_ʖX5XĜCUMY8}8W3itSittėVVr~JJ"NXbN_94#9nDPlD]2]rhFr&e&͓Ȟւ+nP@pP܅u u2ߍL)Ls!s ]Qo6BJ^.Sj/4TE\k0K5UF $]l1+Ls6͂VbGO%^'fm֜y2h,Z)"M`{;t7oWcܬH PBx&e_(!Ygnz: Aî3Di-R J[*#Nar=|<}u>8?vp~X dw@9I QCqȡ @My>|7n 0`[!BEY)R (P 4hc{|7n 0`[!BEY)R (P 4hc{/fހRr5Mj*qZItK^AnQ$Pp9|:#z6[%U1-]㊒)glឨ,c?X≩ 843H _.G奜w hRFC2268 selftest failed (%s). (RFC2268 encryption test 1 failed.RFC2268 decryption test 1 failed.RFC2268 encryption test 2 failed.RFC2268 decryption test 2 failed.RFC2268 encryption test 3 failed.RFC2268 decryption test 3 failed.1.2.840.113549.1.12.1.6RFC2268_40)TPD ,$!%\QM@CCPQA< `cC#( (D@D  "%xsK;;.pp@0 <3?(0226tpD4, TSG\PLXSK=$ $ psC3 2, ,'prB2 ``@ PP@#+  6LCO7XRJxpH8&/`aA!4@AAPRB|qM=  PSC7!=trF6,#/$#'0 +"lbN.LAM haI)|pL<  ?/3>d`D$,".HCK   !!hcK+dbF&5 3|rN>xrJ:DCG%$"&-!000437.426 ""8084'DAEL@L )415 <0 <2><*:LBNTQE83 ;h`H(|sO?HBJ TRFtsG7 -DBF5(# +daE%:#91\RN9&2011*laM-\SO$0 82 :XPH`bB"(! )033( xqI9hbJ*(" *088(! -,&ܳ38/`@ `QET@DDcO/lcK+hSKXbB"`3305! )( "ࣇ'Б <264CK H/쀈`L,l(4AED!3?<1 =< ((BNL62><%9 # +(bF&drJ:x#'$#/,1rB2pBB@AA@sC3pcG'd, 7- ,,*044 .)QM\8SGT. ̂9?qM=|1105 bJ*h1 "" `H(hqA1pؑaA!`>&QIXQAPܒ#+Ё CGD #,쁍 ?sK;xPL\"!cC#`## AM LȒ2 :8 ".,:bN.lRJX23AI HpH8x ;p@0pqE5tsO?|154`D$daM-lpD4t԰4* rF6t >@@@ ్=:0" *(RN\)RFTCC@ 0%@HHqI9x<!!  SO\sG7tPDT2 !%$COLBFD-PHXRBP+rN>| =000aE%d0 <<6$䳋;pL<| P@P1 98"&$220aI)h374' $$$ SCP @L L3 ;8BJ H7)DTP ,%$!M\QC@CAPQ< C#`c(( DD@  "%K;xs;.@0pp ?<3(2026D4tp, GTSL\PKXS=$$ C3ps 2 ,, 'B2prц @ ``@PP#+ 6OLC7JXRH8xp&/A!`aÄ4A@ABPRM=|q  CPS7!=F6tr/,#'$#0  +"N.lbM LAI)haL<|p  ?/3>D$d`.,"K HC ! !K+hcF&db5 3N>|rJ:xrGDC%&$"-Ӂ!000743.642" "8804'EDAL L@)541  <<0A1pqÉ E5tq;8IXQ?I HA 981G'dcӈ8 B@B# #L,l`ӄ$4401HH@O/lc =<1 -,!@@@>><2<*:NLBETQ ;83H(h`O?|sJ HBFTRG7ts -FDB5 +(#E%da:#91N\R9&2101*M-laO\S$0  :82HXPB"`b )(!303( I9xqJ*hb *("880(-,! &38/ ``@TQED@D/lcO+hcKXSK"`bB3035)(! "' <642 HCK/,l`L(4DAE!?<3=<1 (( LBN6><2%9  +(# &dbF:xrJ'$#/,#12prB@BB@AA3psC'dcG, 7- ,, *440  .)\QM8TSG. 9?=|qM1015 *hbJ1 " "(h`H1pqA!`aA>&XQIPQA#+ DCG #, ?;xsK\PL"!#`cC# # LAM:82 .,":.lbNXRJ23 HAI8xpH ;0pp@5tqE?|sO541$d`D-laM4tpD4*  6trF >@@@ =:0*(" \RN)TRF@CC 0%H@H9xqI<! !  \SO7tsGTPD2 %$!LCODBF-XPHPRB+>|rN =000%daE<<0 6$;<|pL PP@981 &$"202)haI743'$$ $ PSC   L@L;83 HBJ7y7snpm"k, JGHQ]tad/}SEED test encryption failed.SEED test decryption failed.1.2.410.200004.1.31.2.410.200004.1.41.2.410.200004.1.51.2.410.200004.1.6SEEDppp,,,'''WWW555 AAA###kkkEEE!!!OOONNNeee|||>>>000___^^^ 999GGG]]]===ZZZQQQVVVlllMMM fff---ttt+++ LLL444~~~vvvmmm111XXX:::aaa222SSS"""DDDzzz$$$```iiiPPP}}}bbbTTT[[[dddHHHuuu ???\\\JJJ333sssgggRRR&&&777;;;oooKKKccc...yyynnn)))///YYYxxxjjjFFFqqq%%%BBBrrrUUU 666III***hhh<<<888@@@((({{{CCCwwwXXXgggNNN jjj]]]FFF'''222KKKBBB:::%%%{{{ qqq___>>>|||```444MMMrrrzzz555aaaZZZ$$$VVV@@@ccc 333hhh oooSSSbbb...(((ttt666"""888ddd999,,,000DDDeeekkk###HHHQQQUUUAAACCC///<<<+++ GGG~~~)))!!!fff;;;777LLLnnnvvv---&&&}}}\\\OOO???yyyRRRmmm^^^iii111 uuuJJJWWWEEEsssYYYlllTTTxxxpppIIIPPPwww***[[[===888AAAvvvٓ```rrr«uuuWWWɢҐ'''IIICCC\\\>>>gggnnn///ⅅ SSSeee꣣쀀---kkk+++666ņMMM333fffXXX::: xxxBBB&&&aaa???;;;Ԙ苋 ,,,oooNNN yyy"""YYY===tttTTT000~~~(((UUUhhhPPP111***ppp222iiibbb$$$EEEsssmmmJJJ...%%%HHH{{{οqqq)))llldddcccKKK___FFF777^^^GGG[[[ZZZ<<>>^^^ 999]]]ZZZQQQlllttt+++444vvvmmm:::222SSSzzz$$$```iiibbbTTTddduuu ݇͐sssRRRƁoooccc)))///xxxqqqԫrrr666***<<<@@@ӻCCCwww'''555 AAA!!!NNNeee000___GGG===VVVMMM fff--- LLL~~~111XXXaaa"""DDDPPP}}}[[[HHH???\\\JJJ333ggg&&&777;;;KKK...yyynnnYYYjjjFFF%%%BBBUUU IIIhhh888((({{{Ǟ%s #}l |:u #EgܺvT2"3DUfw4Nכ #EgܺvT2"3DUfwgg18TisWVHC#EgܺvT2#EgܺvT2CAMELLIA-128 test encryption failed.CAMELLIA-128 test decryption failed.CAMELLIA-192 test encryption failed.CAMELLIA-192 test decryption failed.CAMELLIA-256 test encryption failed.CAMELLIA-256 test decryption failed.1.2.392.200011.61.1.1.1.20.3.4401.5.3.1.9.10.3.4401.5.3.1.9.30.3.4401.5.3.1.9.41.2.392.200011.61.1.1.1.30.3.4401.5.3.1.9.210.3.4401.5.3.1.9.230.3.4401.5.3.1.9.241.2.392.200011.61.1.1.1.40.3.4401.5.3.1.9.410.3.4401.5.3.1.9.430.3.4401.5.3.1.9.44CAMELLIA128CAMELLIA192CAMELLIA256(private-key (dsa (p #00AD7C0025BA1A15F775F3F2D673718391D00456978D347B33D7B49E7F32EDAB 96273899DD8B2BB46CD6ECA263FAF04A28903503D59062A8865D2AE8ADFB5191 CF36FFB562D0E2F5809801A1F675DAE59698A9E01EFE8D7DCFCA084F4C6F5A44 44D499A06FFAEA5E8EF5E01F2FD20A7B7EF3F6968AFBA1FB8D91F1559D52D8777B#) (q #00EB7B5751D25EBBB7BD59D920315FD840E19AEBF9#) (g #1574363387FDFD1DDF38F4FBE135BB20C7EE4772FB94C337AF86EA8E49666503 AE04B6BE81A2F8DD095311E0217ACA698A11E6C5D33CCDAE71498ED35D13991E B02F09AB40BD8F4C5ED8C75DA779D0AE104BC34C960B002377068AB4B5A1F984 3FBA91F537F1B7CAC4D8DD6D89B0D863AF7025D549F9C765D2FC07EE208F8D15#) (y #64B11EF8871BE4AB572AA810D5D3CA11A6CDBC637A8014602C72960DB135BF46 A1816A724C34F87330FC9E187C5D66897A04535CC2AC9164A7150ABFA8179827 6E45831AB811EEE848EBB24D9F5F2883B6E5DDC4C659DEF944DCFD80BF4D0A20 42CAA7DC289F0C5A9D155F02D3D551DB741A81695B74D4C8F477F9C7838EB0FB#) (x #11D54E4ADBD3034160F2CED4B7CD292A4EBF3EC0#)))(public-key (dsa (p #00AD7C0025BA1A15F775F3F2D673718391D00456978D347B33D7B49E7F32EDAB 96273899DD8B2BB46CD6ECA263FAF04A28903503D59062A8865D2AE8ADFB5191 CF36FFB562D0E2F5809801A1F675DAE59698A9E01EFE8D7DCFCA084F4C6F5A44 44D499A06FFAEA5E8EF5E01F2FD20A7B7EF3F6968AFBA1FB8D91F1559D52D8777B#) (q #00EB7B5751D25EBBB7BD59D920315FD840E19AEBF9#) (g #1574363387FDFD1DDF38F4FBE135BB20C7EE4772FB94C337AF86EA8E49666503 AE04B6BE81A2F8DD095311E0217ACA698A11E6C5D33CCDAE71498ED35D13991E B02F09AB40BD8F4C5ED8C75DA779D0AE104BC34C960B002377068AB4B5A1F984 3FBA91F537F1B7CAC4D8DD6D89B0D863AF7025D549F9C765D2FC07EE208F8D15#) (y #64B11EF8871BE4AB572AA810D5D3CA11A6CDBC637A8014602C72960DB135BF46 A1816A724C34F87330FC9E187C5D66897A04535CC2AC9164A7150ABFA8179827 6E45831AB811EEE848EBB24D9F5F2883B6E5DDC4C659DEF944DCFD80BF4D0A20 42CAA7DC289F0C5A9D155F02D3D551DB741A81695B74D4C8F477F9C7838EB0FB#)))pk_dsachoosing a random k generatedsa.c_gcry_mpi_get_nbits ((p)) == nbits_gcry_mpi_get_nbits ((q)) == qbits (transient-key)choosing a random x%sqbits >= 160dsa pdsa qdsa gdsa ydsa xself-test after key generation failedgenerate_fips186_gcry_mpi_get_nbits ((prime_p)) == nbits_gcry_mpi_get_nbits ((prime_q)) == qbits!deriveparmsseeddsa hqbitstransient-keyderive-parmsuse-fips186use-fips186-2domainpqg(seed-values(counter %d)(seed %b)(h %m))(misc-key-info%S(pm1-factors%m)(data (flags pkcs1) (hash sha1 #a0b1c2d3e4f510102030405060708090a1b2c3d4#))(data (flags pkcs1) (hash sha1 #a0b1c2d3e4f500102030405060708090a1b2c3d4#))converting data failedsigning failedverify failedbad signature not detectedconvertkey consistencysignpubkeydsaopenpgp-dsaDSApqgypqgyxrs(private-key (rsa (n #00e0ce96f90b6c9e02f3922beada93fe50a875eac6bcc18bb9a9cf2e84965caa 2d1ff95a7f542465c6c0c19d276e4526ce048868a7a914fd343cc3a87dd74291 ffc565506d5bbb25cbac6a0e2dd1f8bcaab0d4a29c2f37c950f363484bf269f7 891440464baf79827e03a36e70b814938eebdc63e964247be75dc58b014b7ea251#) (e #010001#) (d #046129f2489d71579be0a75fe029bd6cdb574ebf57ea8a5b0fda942cab943b11 7d7bb95e5d28875e0f9fc5fcc06a72f6d502464dabded78ef6b716177b83d5bd c543dc5d3fed932e59f5897e92e6f58a0f33424106a3b6fa2cbf877510e4ac21 c3ee47851e97d12996222ac3566d4ccb0b83d164074abf7de655fc2446da1781#) (p #00e861b700e17e8afe6837e7512e35b6ca11d0ae47d8b85161c67baf64377213 fe52d772f2035b3ca830af41d8a4120e1c1c70d12cc22f00d28d31dd48a8d424f1#) (q #00f7a7ca5367c661f8e62df34f0d05c10c88e5492348dd7bddc942c9a8f369f9 35a07785d2db805215ed786e4285df1658eed3ce84f469b81b50d358407b4ad361#) (u #304559a9ead56d2309d203811a641bb1a09626bc8eb36fffa23c968ec5bd891e ebbafc73ae666e01ba7c8990bae06cc2bbe10b75e69fcacb353a6473079d8e9b#)))(public-key (rsa (n #00e0ce96f90b6c9e02f3922beada93fe50a875eac6bcc18bb9a9cf2e84965caa 2d1ff95a7f542465c6c0c19d276e4526ce048868a7a914fd343cc3a87dd74291 ffc565506d5bbb25cbac6a0e2dd1f8bcaab0d4a29c2f37c950f363484bf269f7 891440464baf79827e03a36e70b814938eebdc63e964247be75dc58b014b7ea251#) (e #010001#)))generate_stdrsa.c p= q= phi= g= f= n= e= d= u= self-test after key generation failedgen_x931_parm_xp_gcry_mpi_get_nbits ((xp)) == nbitsgen_x931_parm_xi_gcry_mpi_get_nbits ((xi)) == 101generate_x931Xp1Xp2XpXq1Xq2Xq_gcry_mpi_gcd (g, e, phi)p and q are swapped p q n e d uderive-parmsuse-x931(misc-key-info(p-q-swapped))transient-keyn(data (flags pkcs1) (hash sha1 #11223344556677889900aabbccddeeff80203040#))(data (flags pkcs1) (hash sha1 #11223344556677889900aabbccddeeff10203040#))converting data failedsigning failedverify failedbad signature not detectedenc-valrsaa(data (flags raw) (value %m))encrypt failedgcry_pk_decrypt returned garbageciphertext matches plaintextdecrypt failedvaluedecrypt returned no plaintextmismatchconvertkey consistencysignencryptpubkeyopenpgp-rsaoid.1.2.840.113549.1.1.1RSAnenedpquspk_elgsign+verifyencrypt+decryptElgamal test key for %s %s failed gen_kelgamal.cchoosing a random k generatechoosing a random x of size %uelg p= elg g= elg y= elg x= using a supplied x of size %uxvalueelgopenpgp-elgopenpgp-elg-sigELGpgypgyxabrsNIST P-1921.2.840.10045.3.1.1prime192v1secp192r1NIST P-224secp224r11.3.132.0.33NIST P-2561.2.840.10045.3.1.7prime256v1secp256r1NIST P-384secp384r11.3.132.0.34NIST P-521secp521r11.3.132.0.35brainpoolP160r11.3.36.3.3.2.8.1.1.1brainpoolP192r11.3.36.3.3.2.8.1.1.3brainpoolP224r11.3.36.3.3.2.8.1.1.5brainpoolP256r11.3.36.3.3.2.8.1.1.7brainpoolP320r11.3.36.3.3.2.8.1.1.9brainpoolP384r11.3.36.3.3.2.8.1.1.11brainpoolP512r11.3.36.3.3.2.8.1.1.130xfffffffffffffffffffffffffffffffeffffffffffffffff0xfffffffffffffffffffffffffffffffefffffffffffffffc0x64210519e59c80e70fa7e9ab72243049feb8deecc146b9b10xffffffffffffffffffffffff99def836146bc9b1b4d228310x188da80eb03090f67cbf20eb43a18800f4ff0afd82ff10120x07192b95ffc8da78631011ed6b24cdd573f977a11e7948110xffffffffffffffffffffffffffffffff0000000000000000000000010xfffffffffffffffffffffffffffffffefffffffffffffffffffffffe0xb4050a850c04b3abf54132565044b0b7d7bfd8ba270b39432355ffb40xffffffffffffffffffffffffffff16a2e0b8f03e13dd29455c5c2a3d0xb70e0cbd6bb4bf7f321390b94a03c1d356c21122343280d6115c1d210xbd376388b5f723fb4c22dfe6cd4375a05a07476444d5819985007e340xffffffff00000001000000000000000000000000ffffffffffffffffffffffff0xffffffff00000001000000000000000000000000fffffffffffffffffffffffc0x5ac635d8aa3a93e7b3ebbd55769886bc651d06b0cc53b0f63bce3c3e27d2604b0xffffffff00000000ffffffffffffffffbce6faada7179e84f3b9cac2fc6325510x6b17d1f2e12c4247f8bce6e563a440f277037d812deb33a0f4a13945d898c2960x4fe342e2fe1a7f9b8ee7eb4a7c0f9e162bce33576b315ececbb6406837bf51f50xfffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffeffffffff0000000000000000ffffffff0xfffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffeffffffff0000000000000000fffffffc0xb3312fa7e23ee7e4988e056be3f82d19181d9c6efe8141120314088f5013875ac656398d8a2ed19d2a85c8edd3ec2aef0xffffffffffffffffffffffffffffffffffffffffffffffffc7634d81f4372ddf581a0db248b0a77aecec196accc529730xaa87ca22be8b05378eb1c71ef320ad746e1d3b628ba79b9859f741e082542a385502f25dbf55296c3a545e3872760ab70x3617de4a96262c6f5d9e98bf9292dc29f8f41dbd289a147ce9da3113b5f0b8c00a60b1ce1d7e819d7a431d7c90ea0e5f0x01ffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffff0x01fffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffc0x051953eb9618e1c9a1f929a21a0b68540eea2da725b99b315f3b8b489918ef109e156193951ec7e937b1652c0bd3bb1bf073573df883d2c34f1ef451fd46b503f000x1fffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffa51868783bf2f966b7fcc0148f709a5d03bb5c9b8899c47aebb6fb71e913864090xc6858e06b70404e9cd9e3ecb662395b4429c648139053fb521f828af606b4d3dbaa14b5e77efe75928fe1dc127a2ffa8de3348b3c1856a429bf97e7e31c2e5bd660x11839296a789a3bc0045c8a5fb42c7d1bd998f54449579b446817afbd17273e662c97ee72995ef42640c550b9013fad0761353c7086a272c24088be94769fd166500xe95e4a5f737059dc60dfc7ad95b3d8139515620f0x340e7be2a280eb74e2be61bada745d97e8f7c3000x1e589a8595423412134faa2dbdec95c8d8675e580xe95e4a5f737059dc60df5991d45029409e60fc090xbed5af16ea3f6a4f62938c4631eb5af7bdbcdbc30x1667cb477a1a8ec338f94741669c976316da63210xc302f41d932a36cda7a3463093d18db78fce476de1a862970x6a91174076b1e0e19c39c031fe8685c1cae040e5c69a28ef0x469a28ef7c28cca3dc721d044f4496bcca7ef4146fbf25c90xc302f41d932a36cda7a3462f9e9e916b5be8f1029ac4acc10xc0a0647eaab6a48753b033c56cb0f0900a2f5c4853375fd60x14b690866abd5bb88b5f4828c1490002e6773fa2fa299b8f0xd7c134aa264366862a18302575d1d787b09f075797da89f57ec8c0ff0x68a5e62ca9ce6c1c299803a6c1530b514e182ad8b0042a59cad29f430x2580f63ccfe44138870713b1a92369e33e2135d266dbb372386c400b0xd7c134aa264366862a18302575d0fb98d116bc4b6ddebca3a5a7939f0x0d9029ad2c7e5cf4340823b2a87dc68c9e4ce3174c1e6efdee12c07d0x58aa56f772c0726f24c6b89e4ecdac24354b9e99caa3f6d3761402cd0xa9fb57dba1eea9bc3e660a909d838d726e3bf623d52620282013481d1f6e53770x7d5a0975fc2c3057eef67530417affe7fb8055c126dc5c6ce94a4b44f330b5d90x26dc5c6ce94a4b44f330b5d9bbd77cbf958416295cf7e1ce6bccdc18ff8c07b60xa9fb57dba1eea9bc3e660a909d838d718c397aa3b561a6f7901e0e82974856a70x8bd2aeb9cb7e57cb2c4b482ffc81b7afb9de27e1e3bd23c23a4453bd9ace32620x547ef835c3dac4fd97f8461a14611dc9c27745132ded8e545c1d54c72f0469970xd35e472036bc4fb7e13c785ed201e065f98fcfa6f6f40def4f92b9ec7893ec28fcd412b1f1b32e270x3ee30b568fbab0f883ccebd46d3f3bb8a2a73513f5eb79da66190eb085ffa9f492f375a97d860eb40x520883949dfdbc42d3ad198640688a6fe13f41349554b49acc31dccd884539816f5eb4ac8fb1f1a60xd35e472036bc4fb7e13c785ed201e065f98fcfa5b68f12a32d482ec7ee8658e98691555b44c593110x43bd7e9afb53d8b85289bcc48ee5bfe6f20137d10a087eb6e7871e2a10a599c710af8d0d39e206110x14fdd05545ec1cc8ab4093247f77275e0743ffed117182eaa9c77877aaac6ac7d35245d1692e8ee10x8cb91e82a3386d280f5d6f7e50e641df152f7109ed5456b412b1da197fb71123acd3a729901d1a71874700133107ec530x7bc382c63d8c150c3c72080ace05afa0c2bea28e4fb22787139165efba91f90f8aa5814a503ad4eb04a8c7dd22ce28260x04a8c7dd22ce28268b39b55416f0447c2fb77de107dcd2a62e880ea53eeb62d57cb4390295dbc9943ab78696fa504c110x8cb91e82a3386d280f5d6f7e50e641df152f7109ed5456b31f166e6cac0425a7cf3ab6af6b7fc3103b883202e90465650x1d1c64f068cf45ffa2a63a81b7c13f6b8847a3e77ef14fe3db7fcafe0cbd10e8e826e03436d646aaef87b2e247d4af1e0x8abe1d7520f9c2a45cb1eb8e95cfd55262b70b29feec5864e19c054ff99129280e4646217791811142820341263c53150xaadd9db8dbe9c48b3fd4e6ae33c9fc07cb308db3b3c9d20ed6639cca703308717d4d9b009bc66842aecda12ae6a380e62881ff2f2d82c68528aa6056583a48f30x7830a3318b603b89e2327145ac234cc594cbdd8d3df91610a83441caea9863bc2ded5d5aa8253aa10a2ef1c98b9ac8b57f1117a72bf2c7b9e7c1ac4d77fc94ca0x3df91610a83441caea9863bc2ded5d5aa8253aa10a2ef1c98b9ac8b57f1117a72bf2c7b9e7c1ac4d77fc94cadc083e67984050b75ebae5dd2809bd638016f7230xaadd9db8dbe9c48b3fd4e6ae33c9fc07cb308db3b3c9d20ed6639cca70330870553e5c414ca92619418661197fac10471db1d381085ddaddb58796829ca900690x81aee4bdd82ed9645a21322e9c4c6a9385ed9f70b5d916c1b43b62eef4d0098eff3b1f78e2d0d48d50d1687b93b97d5f7c6d5047406a5e688b352209bcb9f8220x7dde385d566332ecc0eabfa9cf7822fdf209f70024a57b1aa000c55b881f8111b2dcde494a5f485e5bca4bd88a2763aed1ca2b2fa8f0540678cd1e0f3ad80892scanning ECC parameter failed: %s choosing a random k of %u bits ecc generation pecc generation aecc generation becc generation necc generation Gxecc generation Gyecc generation Gzchoosing a random x of size %u ecc generate: Failed to get affine coordinates Testing key. ECDSA operation: sign failed ECDSA operation: sign, verify failed ECDSA operation: sign, verify ok. Bad check: Point 'G' does not belong to curve 'E'! Bad check: 'G' cannot be Point at Infinity! check_secret_key: E is not a curve of order n Bad check: Q can not be a Point at Infinity! Bad check: There is NO correspondence between 'd' and 'Q'! ecc sign: Failed to get affine coordinates ecc verify: Rejected ecc verify: Failed to get affine coordinates x y r secc verify: Not verified ecc verify: Accepted mpi_print failed: %s mpi_scan failed: %s curveecc get param: Failed to get affine coordinates pabgnq(1:%c%u:)low-levelpubkeyecdsaeccECDSApabgnqpabgnqdrsCRC32CRC32RFC1510CRC24RFC24401.2.840.113549.2.4MD41.2.840.113549.1.1.41.2.840.113549.2.5MD5/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqshort string# }"4"BwU*你labclong stringu8Q'v]]PE\RR%%abcdbcdecdefdefgefghfghighijhijkijkljklmklmnlmnomnopnopqone million "a" yFU ػaK?BXHNgdigestxAA@]"#aza$ja8& >`9gH m9,2.16.840.1.101.3.4.2.42.16.840.1.101.3.4.2.11.2.840.113549.1.1.11SHA224SHA256"(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDlshort stringu?E^=iP',2c`ZC[퀆+#X4%abclong string 3 3G=/ǂGS;;/U~-ft`9abcdefghbcdefghicdefghijdefghijkefghijklfghijklmghijklmnhijklmnoijklmnopjklmnopqklmnopqrlmnopqrsmnopqrstnopqrstuone million "a" qdtnN1 JHRyrpL*[8뮗=digestݯ5azAsI A1N~ KUӚ!*'O6<#EMD#d<*OLuڌ(?wyrP(I3ĵC:)&T^[K H= idN.BǼc; D(V2sD~ LC,w\,I.N2.16.840.1.101.3.4.2.31.2.840.113549.1.1.13SHA5122.16.840.1.101.3.4.2.21.2.840.113549.1.1.12SHA3841.3.6.1.4.1.11591.12.2TIGER192O#RoyҦ65{ `WK.J7wk )Xg>]ؕ}A'Gf|3Z-0x`&F###~?oL&mbڸ  nBO!OOl666QY oyyy0_ooom?~RURRG'```5evʼ7+ͬV[ql<` 0 {{{j555:itGS!{ל^/C\m...)zbK1KK]!ծWAWW*ATwwwn777V{#ٌF# jJ5JJDOڢ%X}XXϏ|RU)))Z"P ( PO]ikkk\.>>- (xgggSsN%'''sX2AAA ,SQ}}}I7ܕnVGp0q#|||qfff{Sݯ.K\EFGGG!܄BԉXZu---.cyƿ?8G#/ZuZZl6f333\?ccc I89⨯qqqƍ2}d;prI9II_C1HK㹶*[q[[ 4>)ȤR L-&&&d222Y}Jjw3x<3st:'a|¾&͉h4442uzH=HHT$zzzd=z>_a__=@ ghhh4rhA,}u^ɴ괴ΨTMTT;v/D """cddd*梿sss$ZHz]:@@@H(@ V+{3MK_az===[3̗f6nVE+++쳗vvvd2(6wltw[C)wjjj P]PPWLE EE8`000t+~???ǪUIUUYyejeeeihҺJ^e///N'`_8lpF.dRM)MMv9r꼏uuu6 0 $Ky@򲲅Yc~6p8>c|U7bbb:wԁM2)R1Ėbb:f3J5%%% YyYYT*䧷rrrr999aZL-LL;^e^^xxxp888 cW AMCN/aaaB{E4B!!!%֔JΙ"UD kJN%NNfsQѷ混` x<<<|>@5Ԕj og޹&_LQX},,,kӌ\k9Wnnnn7 ܬVEVV^ID DDO7!gTM*** kmֻF#SQSSrWS'X , 'ӜN+Glllb111蹇ttt LC FFFE& <(DPB[,NXt:::oiiiA-H $ ୧pppoqTٶⶶg~;.hW*BBB,-´ZUIuP](((1\m\\k?D"0x`F###&~?ƸoL&mbڸ nBO!OO l666QYo yyy_ooo0?~mRURR'```Gevʼ5+ͬV7[q<` 0 l{{{j555:itGSೳ{!^/œ\m...CzbK1KK)!]WAWW*ATwwwn777V{#ٌF#jJ5JJ OD%X}XXRU)))|"P ( ZOP]ikkk\.gsν<4]i]] P@ |>>> (-gggxSsN%'''X2AAAs ,SQ}}}7ܕnIGV0pq#|||fffqS{.K\FGGGE!܄BZu---Xcyƿ.8?G#/ZuZZl6f333?ccc\ I89⨯qqqލ2}dђprI9II;C_1HK㨶*[q[[ 4)ȤR>L-&&& d222}JYj3x<ws3t:a|¾'&h444uzH=HH2$Tzzz=zd>_a__@ =ghhh4rhA,u^ɴ괴}TMTT;vD """/dddc*梿sss$ZH]:@@@z(@ HV+Õ{3߫KM_az===3̗f[6VE+++n쳗vvvd2汩(6wlw[tC)wjjj P]PPLE EEW8`000t+~???ڪUIUUYyeeeejihҺ^e///JN'_`8lp.FdRM)MM9rv꼏uuu 06 $y@KYc6p8~>c|7bbbUw:M2)1ĖbR:bf3ţJ5%%% YyYYT*䧷rrrr999aZL-LL;^e^^xxxp888 cW AMC/aaaN{EBB!!!4%֔J"UD kJN%NNsQѷ混f` x<<<|>5Ԕj@ og޹&_LX},,,Qk\kWnnn9n7Ī VEVV܈ID DD^O7!TM***gkmֻ F#SQSS񥋮Wr'X , S'ӜNGlll+b111蹇ttt C FFFLE& <(DPB[,NXt:::oiii-H $ A୧pppqTٶⶶog~;օ.W*BBBh-´Z,UIP](((u1\m\\?kD"x`0###&F~?Ƹo͡L&bڸm nBO!OO 666lYQo yyy_ooo0~m?RURR'```Gvʼ5eͬV7+q[<` 0 l{{{555jit:GSݬ{!^/œm...C\zbK1KK)!]WAWWծAT*www777nV{ٌF##jJ5JJ OD%X}XXϏU)))|R"P ( ZOPi]kkk֫\.sν>>|(- gggxSsջ%'''NX2AAAs, QS}}}ܕnI7GV0pq#|||fffq̎S{K\.FGGGE܄B!ԉu---XZyƿ.c8?#G/ZuZZl6333f?ccc\ 89Iqqqƍ}d2prI9II;C_1HK*[q[[4 ȤR>)-&&& L222dJY}j3x<ws3t:|¾'a&444huzH=HH2$Tzzzzd=>_a__ =@ghhhrh4,A^ɴ괴}uTMTTΨv; """/Ddddc*sssZH$]:@@@z(@ HV+Õ{3ŐKMa_===z̗f[36E+++nVvvvd2(wl6[tw)Cwjjj P]PPLE EEW8000`t+???~UIUUǪyYeeeejhҺie///J^N'_`lp8.FdRM)MMrv9uuu06 $ @KyYc6p8~c|>7bbbUģw:2)MĖbR1:bf3ţ5%%%J YyYYT*rrr999raZL-LL;^e^^xxx888p c AWMC/aaaNEB{!!!4B֔J%fxUD" kJN%NNQѷ混fs` <<Ԕj@5 g޹o_L&},,,QXk\kWnnn9n7Ī VEVVܬID DD^7!OM***gTmֻ kF#SQSS񦋮Wr'X , SӜN'Glll+111bttt C FFFL& E<DP(B[NX,:::toiii-H $ ApppTٶⶶoqg~;.W*BBBh´Z,-IU](((uP1\m\\?kD"`0x###&F~?ƸoL&ڸmb BO!OO n666lYQo yyy_ooo0~m?RURR'```Gʼ5evV7+q[` 0 l<{{{555jt:iSG{!^/œm...C\bK1KK)z]!WAWWծT*Awww777n{VF##jJ5JJ ODX}XX%ϏU)))|RP ( Z"POi]kkk\.ν>>|(- gggxsS%'''N2AAAsX, QS}}}ܕnI7GVp0#q|||fffqS{\.KGGGEFB!ԉu---XZƿ.cy8?G#ZuZZ/l6333f?ccc\ 9I8qqqƍd2}rI9II;pC_1KH[q[[*4 R>)-&&& L222dY}Jjx<w3s3t:¾'a|&޽444hzH=HH2uT$zzzzd=_a__> =@ghhhh4rA,ɴ괴}u^TMTTΨv; """/Ddddc*sss梐H$Z:@@@z]@ H(V+Õ3{KMa_===z̗f[36E+++nVvvvd2(l6wtw[C)wjjjߺP]PP E EEWL8000`+t???~ÒUIUUǪyYeeeej칺Һihe///J^N'_`p8lF.RM)MMdrv9uuu06 $ Ky@cYp8~6|>c7bbbUw:)M2ĖbR1b:f3ţ5%%%JYyYY T*rrr999rZL-LLa^e^^;xxx888p cAW CM/aaaNB{E!!!4BJ%xшD"U JN%NNkѷ混fsQ `<<Ԕj@5 ޹ogL&_},,,QXkk\Wnnn9n7Ī VEVVܬD DD^I!O7M***gTֻ kmF#SQSSWrX , S'N'Glll+111bttt FFFLC E&<P(D[BX,N:::toiiiH $ A-pppٶⶶoqTg;~.*BBBhWZ,-IU](((uP\m\\1k?D"`0x###&F?Ƹ~o&Lڸmb O!OO nB666lQYo yyyooo0_~m?RURR```G'ʼ5evV7+ͬ[q 0 l<`{{{555jt:iGS{!/œ^...C\mK1KK)zb]!WAWWծT*Awww777nV{F#ٌ#J5JJ jODX}XX%Ϗ)))|RU ( Z"PPOᠺ]ikkk.\ν>>|- (gggxSs'''N%AAAsX2 ,SQ}}}ϕnI7GVp0q#|||fffqS{\.KGGGEFB!܄ԉ---XZuƿ.cy?8G#ZuZZ/6l333fccc\? I89qqq⨯ƍd2}I9II;prC_1HK[q[[* 4R>)Ȥ&&& L-222dY}Jj<w3xs3:t¾'a|&444hH=HH2uzT$zzzzd=_a__> =@hhhgh4rЮA,괴}u^TMTTΨv;"""/D dddc*sss梿H$Z@@@z]: H(@+ÕV{3KM_a===zf[36+++nVEvvv쳗2d(l6wصtw[C)jjjwP]PP E EEWL8000`t+???~UIUUǪYyeeeejҺih///J^e'N_`p8lF.M)MMdRrv9uuu꼏6 0 $Ky@Yc8~6p|>cbbbU7w:M2)bR1b:3ţf%%%J5YyYY *Trrr䧷999rL-LLaZ^e^^;xxx888p݌ cƥW AMCaaaN/B{E!!!4BJ%֔xD"U N%NNkJ混fsQ` <<|j@5 ޹ogL&_,,,QX}k\knnn9W7Īn VEVVܬD DD^IߩO7!***gTMֻ km#FSQSSWr , S'XN'Ӝlll+G111bttt蹇 FFFLC E& <P(DB[X,N:::tiiio $ A-Hppp୧ⶶoqTg~;.BBBhW*Z,-´UI(((uP]\m\\1k?"D`0x##&F#?Ƹ~Ƈo&Lڸmb !OO nBO66l6QYo yyyoo0_o~m?URRR``G'`ʼ5evV7+ͬ[q0 l<` {{{55j5t:iGS{!/œ^¸..C\m.1KK)zbK]!AWWծWT*Awww77n7V{F#ٌ#5JJ jJOD}XX%XϏɤ))|RU)( Z"P POᱺ]ikkk.\ν>|>- (ggxgSs''N%'AAsX2A ,SQ}}}nI7ܕGVp0q#|||ffqfS{\.KGGEFGB!܄ԉʴ--XZu-ƿ.cy?8G#uZZ/Z6l33f3cc\?c I89qq⨯qƍd2}9II;prIC_1HKq[[*[ 4R>)Ȥ&& L-&22d2Y}J鰃j<w3xs3:t¾'a|&44h4=HH2uzHT$zzzzd=a__>_ =@ hhghh4rA,괴}u^ɴMTTΨTv;쓈""/D "ddcd*ss梿sH$Z@@z]:@ H(@+ÕV×{3KM۾_a==z=f[3̗6Ϭ++nVE+vv쳗v2d(l6wtw[C)jjwj]PP P EEWLE800`0t+??~?IUUǪUYyeeejeҺih//J^e/'N_`p8lF.)MMdRMrv9uu꼏u6 0 $Ky@Yc8~6p|>cbbU7bw:ԚM2)bR1Ėb:3ţfŔ%%J5%yYY Y*Trr䧷r99r9-LLaZLe^^;^xxx88p8 cѮW AMCaaN/aB{E!!4B!J%֔xD"U %NNkJN混fsQѷ` <|j@5Ԕ ޹ogL&_,,QX},kӻ\knn9Wn7Īn EVVܬV DD^IDO7!**gTM*ֻ km#FQSSSWr, S'X N'Ӝll+Gl11b1tt蹇t FFLC FE& >|>- (ggxgSs''N%'AAsX2A ,SQ}}}镕I7ܕnVGp0q#|||ffqf{S.K\GGEFG!܄Bԉ--XZu-.cy?8G#ZZ/Zul633f3cc\?c I89qq⨯qƍ2}dII;prI9_C1HK[[*[q 4>)ȤR&& L-&22d2ȰY}Jjw3x<3st:'a|&44h4HH2uzH=T$zzzd=z__>_a =@ hhgh4rhA,}u^ɴTTΨTM;v""/D "ddcd*ss梿s$ZH@@z]:@H(@ ÕV+{3MK_a==z=[3̗f6++nVE+vv쳗vłd2(6wltw[C)jjwjPP P]EEWLE 800`0t+??~?UUǪUIYyeeejeih//J^e/N'`_8lpF.MMdRM)v9ruu꼏u6 0 $Ky@Yc~6p8>c|bbU7b:wM2)R1Ėbb:ţf3%%J5%YY YyT*rr䧷r99r9LLaZL-^^;^exxx88p8 cW AMCaaN/aB{E!!4B!%֔J"UD NNkJN%fsQѷ` <@5Ԕj og&_L,,QX},k\knn9WnĪn7 VVܬVEDD^ID ᩩO7!**gTM* kmF#SSSQrW S'X ,'ӜNll+Gl11b1tt蹇t FFLC FE& <(DPB[,NX::t:iioi A-H $pp୧pݶoqTٶg~;.BBhW*B,-´ZUI((uP](\\1\mk?džD"0x`#&F##Ƹ~?oL&mbڸ O nBO!O6l66QY oyyyo0_oom?~RRUR`G'``5evʼ7+ͬV[q l<` 0 {{{5j55:itGS!{œ^/.C\m..K)zbK1K]!WծWAW*ATwww7n77V{#ٌF#J jJ5JDOX%X}XϏ)|RU)) Z"P ( PO]ikkk\.|>>- (gxggSs'N%''AsX2AA ,SQ}}}I7ܕnVGp0q#|||fqff{S.K\GEFGG!܄Bԉ-XZu--.cyƿ?8G#Z/ZuZl63f33c\?cc I89q⨯qqƍ2}dI;prI9I_C1HK[*[q[ 4>)ȤR& L-&&2d22Y}Jjw3x<3sՀt:'a|¾&4h44H2uzH=HT$zzzd=z_>_a_ =@ hghh4rhA,}u^ɴTΨTMT;v"/D ""dcdd*s梿ss$ZH@z]:@@H(@ ÕV+{3MKۡ_a=z==[3̗f6+nVE++v쳗vvd2(6wltw[C)jwjjP P]PEWLE E80`00t+?~??UǪUIUYyeejeeihҺ/J^e//N'`_8lpF.MdRM)Mv9ru꼏uu6 0 $Ky@Yc~6p8>c|bU7bb:wԨM2)R1Ėbb:ţf3%J5%%Y YyYT*r䧷rr9r99LaZL-L^;^e^xxx8p88 cѥW AMCaN/aaB{E!4B!!%֔J"UD NkJN%NfsQѷ` @5Ԕj og޹&_L,QX},,k\kn9WnnĪn7 VܬVEVD^ID DO7!*gTM** kmֻF#SSQSrW S'X , 'ӜNl+Gll1b11t蹇tt FLC FFE& <(DPB[,NX:t::ioii A-H $ p୧ppoqTٶg~;.BhW*BB,-´ZUI(uP]((\1\m\k?D"whirlpool_addwhirlpool.c! (buffer_size || carry)WHIRLPOOL1.3.36.3.3.1.21.3.36.3.2.1RIPEMD160short string>6Gj>%qxPl؝abclong string>D;nJQ)Fpabcdbcdecdefdefgefghfghighijhijkijkljklmklmnlmnomnopnopqone million "a"4<ڤ+ۭ'1e4odigest1.2.840.113549.1.1.51.2.840.10040.4.31.3.14.3.2.261.3.14.3.2.291.2.840.10045.4.1SHA1initialize_basicsfailed to create the pool lock: %s failed to create the nonce buffer lock: %s failed to acquire the pool lock: %s failed to release the pool lock: %s (hwrng failed)random usage: poolsize=%d mixed=%lu polls=%lu/%lu added=%lu/%lu outmix=%lu getlvl1=%lu/%lu getlvl2=%lu/%lu%s mix_poolrandom-csprng.cpool_is_locked_gcry_rngcsprng_set_seed_filecan't lock `%s': %s waiting for lock on `%s'... read_seed_filecan't open `%s': %s can't stat `%s': %s `%s' is not a regular file - ignored note: random_seed file is empty warning: invalid size of random_seed file - not used can't read `%s': %s note: random_seed file not updated can't create `%s': %s can't write `%s': %s can't close `%s': %s read_pooltoo many random bits requested add_randomness/dev/random/dev/urandomno entropy gathering module detected do_fast_random_pollSlow entropy gathering module not yet initialized No way to gather entropy for the RNG WARNING: using insecure random number generator!! _gcry_rngcsprng_create_noncefailed to acquire the nonce buffer lock: %s failed to release the nonce buffer lock: %s p@Abasic_initializationfailed to create the RNG lock: %s failed to acquire the RNG lock: %s failed to release the RNG lock: %s memory corruption detected in RNG context %p x931_get_dtrandom-fips.clength == 16fips_rng_is_lockedgettimeofday() failed: %s encrypt_aesAES encryption in RNG failed: %s x931_aes_driverrng_ctx->cipher_hdrng_ctx->is_seededtempvalue_for_x931_aes_driverduplicate 128 bit block returned by RNGentropy_collect_cbentropy_collect_bufferget_entropy!entropy_collect_buffererror getting entropy data x931_generate_keyerror creating cipher context for RNG: %s error creating key for RNG: %s x931_generate_seedx931_reseedget_randombufferrng_ctxfork without proper re-initialization detected in RNGsevere error getting random _gcry_rngfips_initialize!nonce_context->test_dt_ptr!std_rng_context->test_dt_ptr!strong_rng_context->test_dt_ptrselftest_katerror creating cipher context for RNGerror setting key for RNGX9.31 RNG core function failedRNG output does not match known valuefork detection failedKATrandomcan't open %s: %s error setting FD_CLOEXEC on fd %d: %s /dev/random/dev/urandomneed_entropyselect() error: %s bogus read from random device (n=%d) read error on random device: %s mpi rounding to ceiling not yet implemented _gcry_mpi_powmmpi-pow.c!bp_marker!mp_markerres->d == rp_gcry_mpi_mulpowmmpi-mpow.cki==ktk < 10idx >= 0 && idx < (1<6FMБ)Y >"cUe$4gU8D<́:xz.?g)f[̧`1Y & !7(FTPḑ /'c_հDcdOQS\:5qEvH@1axҵk~dG.sc"D^"@^iNj29I9DHbk%FƂL|ŜꞩnJRͦܦ&歊 Ȩo 5G>YfK*Z8N:O'$4g>ix<%3blzHPW|nW;Nh#ħyţND>:ŴO*+X<: .@0$cIRPḑf 5/%N,`$ λFŦx1m8` FR>qKz{;Vࣇd".' %TXuZJmOe걣MJkKcn 87|ޥaO$l#yNxzгE|ڨ3ָ'N依Nap.il :hTͦܦsVul 鱵ݎ6U>3'9>y"~gF7&t'Y2$4gFV7EiJvK-oP6۩^y'\xcA O-̧݁Bc{贛FJ7RkV7_%!]jROs? 싑Z]xePḑ{jw]}ߩn^?޽qr]- D, 3`&_\v*IR!_ē ّŅ9I-O1;G#mFN>-idH*Oe/x\Xz՘WKgZd(c?)7$ ЕWoΣs׎-h[EG+  a'RiÃ;|.. kl.kl/kl3k^0Pbu1 161  (vnqB!B4BGBZB |cSST%T8TRTfTzTTTTTT @AAT@ @AAT @AA___ __]__abbcldJgYYhhhi i ihif~~T;ʂ>|w    (19@HOiijj jj!j$jj|˚Rǝn|4:> DKSTDѻʽeϸ0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-W_v]v0j{0 0 *H w  P7X0 0 *H ( @ X0-0  `He010  `He 5  yx h<  x h0Q0  `He@0A0  `He0L  @$ !8N_  0$ ^ |CKB [r:mx)pɡsuÃ*k2dpX>Fq\SiA|ލTL MojZ#/W!aroHKAR&GYyŅOKov}RB6c07'hinŴ=vv}BƜ\dB3$x8}.<4k_ `Tr_lOۤ"YqigEeR `yNH-;SvlS{5mW7zzfPq5JBt j$%/9w*윴s/8Q?V(CXE\=i_׶3Dɱ&<"+; 1TYe@ϣ&N5# +Nuc5՝F@@L:z.j>j?k`(Fn=e*"bG U]*逸 ĆQÄ|mXS(v^,&Ґ˔u*d>߯X#(ѧ0Qo,FN*q|3{>9enmty)3q]8[duH|g{|1=K#lMIXq&8cMGbsFE`U4ΏٔʺHhow0$cdn+}3%(pKBk,m ˁ7=ofCUQǀ1+/ߺ2h\V=Uk_夿κ A2]Ds4Z𖦼l(e$JR.Q ZUםNy%3>[) TsG~A4$)mS}598`}Ggvݪ닓bzy )'a1bM\E΄^!b 3䓂,,, ZG ϣYDRv$ը&]> 9jUKcGl:zݞfƞQ#IѢWqE}"LA2_.n:\^au{)6ë/@L] ߥHً>~?WӠEt%.Ѣ^RfIzhΐ .;_t ֳw7Bn~fϪM5x+J(-gO ]sQ&" aV/8Z0UNb'6%1Fp{eO9޲CT0?# <oWLF27e|~YhDYa[Դ/vwЮ[P=L^uhߴ"N!.S*  92P47Mr B #iĈF[xi$L{5!{@ξXf+.'ް%A&6wK{d91X$6-܋hV<`Q6ҊY'_ g˩ CJˡ6pKVxR?JywPP8c:xgzbP?wIDJy;k D-T,C<\fg7+a#'y'V%ჾI~!e|HmkE4Sݚj" "VnP]7X<±Oju}ns%l:E0ir-JC81gx;2r;t'6cRN 3_P̢ͥ0-tISmW-(AHfַ2wI:ltac~ؕ=d;+ H 0zx`8!Z|"i `geי'~uĒn-; e.oJQ=7* O)\> S^PEϠ4ʇQ~ 6Qij84̉WY?ŕ"=T3*fv{A6SA%w".F_lHnTܯƿ1ٷ*'ק@ż mV mxty*x%5ӛ ]8Apq \bOХ kT+bY}E575r^ 2`+/g,y,d$ѭ &j PKjxZCLc6"fJG{ªsjXzf&ʑvVguH\?[mtn(QDG4^.a箠,@eQ d3Knrb);p01FlK~Ód}w!{sk.1cwoHRScLR\jd]hj,Q:`V8b~6ױwYntslRKsZsU?IEA0SY GX2F_ -6+ e}O`n$,x⊚ȶ*{r'GM! ~GpVCouIhZaBԭzNUPߡ*V/:&֏ M:Ju=ʙ<{G-qSph^(\7 ŀe7C(PMo@v;0 ,7iCfεN!fsۋa MWֺ)}[%>a?- yW;5axԫ&}r>kc0JJ շj?&WB-=r`yI3ABrƜ6| %45IN)N$PF̊cc/xEz]|5FcNd[-szB&%!PQlH9ע˴], u|al[ؕ+i`2A_hBVݹHҤoI/ 1X#,Ҧ۪jWk ]'Ky+[;D19Y2-K ktǁ0uÔ {Ìg9)/B|vK$g=fW Xg zɢWl{կOkbLߔ:H[7/;˨#)}uD͟&ѽ(9fJ!|z)ZvtR΃DR?[Z ZC3 <$Fn/a7ZeLkJCkyboMT̺l>%O%.8ދֆTvJ]E+0Mp<1m>GߟÍ~R8B@KD~Zds;_uU%~Nt/SqX0Nvbn=oY&YŨ=)eLMn3_'G?3@ k9,4%CRb~ZaUfo ,Ӓ-ZEtGI򺞣3cbTn@&T;jV+ --n k R: ˜BYE1b6sHk zW jDgFux)hO">q";.W0/?|ìFϟ `.3:HajnBب\stJRsIgӛ $~D6 elyC}ɹ( toVaG{_[zox0cjz ЛJK+N>Vj4Y7(L0 5q9zhzi5B-(vyzݥ7] 9XF:rTǜ&=2|,#dvBG$U8VvG-g^(M1+De|Ǒ+6,UFN{_\ECaS[^Ԩ!b*WAӼC%ƤDbee3 !HT!cm^>į wr:r {N>U!ʦ`Pö~h^DZl7<=*.ծx`.b㣆=Q9&5*n} 3WؗbY簍!)~)UE:pl+B%kY̔VT"s `<=Ė[Ŝ4U!8xj$Ph)#ly|Sܰ(᪮)K=I:וhA,kߵ7-%]X p*7\?QMR[%Q<4)@<]o[t>BY/yP'7`} Z^#ӐmHV{2Pn!5η6JK$z*'iUL7%K]ەK/iӒ fJFi shI_fdD}'u\ak̕뼹 OgYeu#1oE>qZWTa@`ĺoLEidIAp[&;ӞW`mU<2&`[YFL|EU)YQe¯5v E=~ R{YSVH Co\z^N5o>֜" i t F@ln:$IpX=$ac2D}Š٫[KZIm-O5ԓ@eKڿ* |$|2šn f6fi}!å}':Ք"dۉaļ3=jL꛹\BTKqjj{"̨1+G8$_FXH y(As w!E\pkz8Pdo`v b]0ZT_"2[GhO- +ٹyC- SH~;/Gxs Ba 9.*+e9"`%n&0qv>e&p61ɱtP\YpB Jyl%Y Nthlqg0sw a/Zۻajg>Q郞Krd \ 7uӱ4]% 354BЯ~P*5DėЙ I{ADŷ;&lj/u,@rٕT*=r/UBxN31,b|O ]f/US]'?A@lFY ߒ7?^.7Ἥ)1\D>AxҠxLɥ(w(.A9,ɯ^&%j w¼m:7[gJЙTҿ4R}do[at>'ܬ@aW7ZwibRV=F:dnC?Ȟ~0w'LH3,/CoݧGf`Dzd7%rvpN-=C CO#"m9< 6i"6^Lxк8FR8z38NJtHJgͭlǟ 43 N_#Y)_&J4n*:8EW, k/xuoybZS){Bt#tv+`St£vKcj<ɼEm>!GM'}Q)?Pskkhc;=ۡUVK\n5QNh>hKOR?6Fn^PqЙq<N eZ.hV^]zy#q{᝹.#E3!RפYr|V8u=c髍59r ޷-IbAUk[M.m~īW?5ΐViWs9BJ# (PzM4Q1X{"d;1ջ_ܠEce&(Q?`]IP@Mvpl+UA6Zp D`OuM(CVeP_Sב% r#2cso90)0  +G Ul 4 @4 x `@$.LULN0!0 +$,94 4 NƂ\0!0 +&4F(5 @5  \֠Bmv;Hh€(%R)ՄEwB=@fI'Ba.A!HAq/L:i386/mpih-add1.S:i386/mpih-sub1.S:i386/mpih-mul1.S:i386/mpih-mul2.S:i386/mpih-mul3.S:i386/mpih-lshift.S:i386/mpih-rshift.SGCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2GCC: (GNU) 4.2.2.symtab.strtab.shstrtab.hash.dynsym.dynstr.gnu.version.gnu.version_d.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.ctors.dtors.jcr.data.rel.ro.dynamic.got.got.plt.data.bss.commentP!   )1o))>o++8Mo , ,P\ \,\,e t?t?8 nAA/iAAt`F`F@zddT TT   ,(  8 M ] o ~8 8 T :  _  P ݪ  ,   J . e  .(  8 ,0 >1J M8 b8 s2  4) 3I  `e    H 45g <g D EC TE !cFC F /PMI 98 N8 _7I l o r u x { ~  M)  V VC W)  !D`C `R AtI a 8 8 qm @@@@@@@@@@@!4>Ot `8 uy 8 ϰ uz  LV 8  J$  `  Q8 /K DԷK Yy gK vK .l 3 @ @ @ @ @ @ @ @ @ @ @ @ @ @  @ @x 8 8 й C I 0O #N e 62 A| RHF e p|     ,    | # 0 C V hH ru [  l ul q   @ (  (4 @ (!@ $@ '@ +@* 7@+ C O8 d8 uT4l l NI N ]C ] lC 0-   @- $ . >nw Ro6  kO 8 8  Jl^ b E lb k kC lC  T. M / n eq Z8 o8 t v% v)     8  ?0 8  9   & `1 * `5 . `9 2 `= 6 `A@ 9 9 N 9 y ; _ |I }R k cC eR x C A A A  ( `B `F `J `N 9  !9 !@ /B -!AO >!AO O!dR c!R  p!R !R !R !R !R ! (!@ (! (! U "Y ~ 9 $9 DT ":E "MG3 ("9V# -"\W 4"\  F"H O"] a" O r"U "YYy .a  "a@ "b "b "c "ld% "^L "_L "dQ e #eU Jg, # !` " d= "xg )#x 0#Fy 7#Ai F#]e  X#i e#e w#wo #f #p #:f #p r"1xy #[{ #{Q #>|R #~? #~ $T` $ ,$ 5$; @$ʂ% N$ ^$gL s$`gL "Q  .  $ $D $<| , $ ~(9 ,9 T $ $Z] "/ ԕ { ("B -"U' $[i " $i  F"p $ r"R %| %|O (%˚ =%R I% U% ^%ǝ i%n% w% %`%~09 49 %^ % % %'k % " %& %: " ("|r -" r"{ % % % &@ &ϸ0 & 5&ѻ >&ʽ I&e% W& N$ b&ok . r& ~& &W &_ &v6 & &Y & &0K &{ & '; "'PI   $ +'7S 5' ?' H' L' Y'I  z b'S l' v' H'( '@ 'q 'yq ' { e 'xW ': '  ? \? T ' ' ' ' ' ( (` V ( +(  8( ? ? $ T D(L O( _(_ j(      $  , z(x T (  (Q  B  (W (8 ( H' 4 (@4 (P ( ( ( ( ( ( ( ( ($9 (]0 ) )J &).L' 6)UL F)N ?Ot3  U)ƂW b)  o) H'4 {)4 ) S s#  )y )[ ) d? 3 H'(5 )@5 ~89 <9 )U )@9 )D9 )P )H9 * LV !*9 0*V <* G*9 O*9 \*9 d*v y*9 *9 * *\  *9 *9 (*9 A *XK \. *i *  +L9 "+P9 7+V4 @+ R+9 a+ݾA p+ + +9 +6h +9 +C  +5 +9 +9  ,9 ,C #,f 7,9 D,p V,9 d,9 x, ,d9 ,c ,h9 ,l9 ,p9 ,: , - : -@j /-$: B-V K-V V-V  c-vX p-: ~-: -: -: - : -  - -8: -<: -@: .0 .  #. /. 8.& J. Z.(: x. . . .,: .0: .4: .  /\ / '/Go 9/J D/l V/ i/  {/  / /q  /5 /9p  . P .c  / /D: /h / /6  06 0 ,0,h 80U J02{ _04z k07u y0 ? ? ?. 0F% (F 0Ma 0N 06 |0 0e k l l. %o^ 0o: 0%p: 0_p: 1p: 1p3 1 1 1( 1 1 1 1  1 1z 1p !1 '1҅ *1ȅ 01" O1Jl? f1Ī5 |1Ӻ? 1  (1` (1\ 1nS 1\ 1o" 2} (26 B2E P2m  g22 x22sI 2.& 2! 2*> 22T 2 3a 3p" )3r' 33)! H3F _3 <u3 3E 3 3 32! 3 ,3(7 4" )4I E4S c4N {4PGw 4H 46gL 4' 4- 4 4< 5^ (5w  <50 T5a~ d5 x5J 5p 5 5K 5I9 5 5 6# #6'd 46Y F66 b6Ù x6+ 6" 6!2h 6x) 6 (6{T^ 7\o 7o 47$D M7AI l7l |7j 7? 7'cs 7.Z 7B; 7  (8c  8 /8  @8 [82 k8d q8" y8 8۴, 8lj 8%m 8v= 8 m 8s7 82 9M 9р# ,9s` G9> `95 w93 9O 9$ 9 9: 9` (9h :" ):P :: [: o:݈ :s- :)p : :2 :4 :;t\ #;r 5;@ E;Un V;ُ i;ft( y;/9 ;D ;s` ;j ;38 ; ,;a <J 7<7i I<4W [<! j< <w  < <, </  <WsC <= =Dj = ,2= O= y h= = = = =Ul =rB = =. >' '>guE 8>_" W>z l>%e |>` ,> >i/ > >5[ > (? 9) (?@ ,E?F a?w q?  ?c ?>1 ?Q ? ?  ,@q @l +@a C@ (s b@b~ y@L @^ @  @ : @a# @H: @? @& A_l !AfW 9AH UAD  oA Ad A A[9 Ad~ AD+ AMj Al B+v )B69 =Bh VB" hB  B2 B B] B(c B, B8J C ,%C^ 4CO JC _CH }CxB Cl C:2 C@ CD C Cn] DW DP  1D DD6Z[ UDc2 qD D. Dm D6B D_n  D D D֐2 En E 5E ,NEG ]E;e tE E: E9 E? EI Euo> E` ,E6 Fs( FIB 9F- KF dFd }FƲ FY F-& Ff F5 (F? F8m GQ (GG* :G{s( IG  ,cG uGk/ G G G G,G Gյl H _ 3H8 IHU] ZH07 hH yH\ HY= Hj H? H Hjk H H  Iղ& +I ?I\7 KIu bIm qIa  IE I}l I7= I? IW Il2 It I 1 J- 'JN N'; VNJg kNxb1 }N|/p N: N· N}h N&D NtN Ny OPvB -O$ ?O ,VO<C jO> O; O O" O, ONS Ou Ox  PzN P4 *PB ?P (XPJ<? lP P <P^kZ P  P8 P  PJ QO #Qf 8Q. KQg `Q= Qq Q, Q# Q/o^ QD? R R.! 1R]<1 MR cR;K yRT ? Ri R Rh] R R R!> S> %St. 6S,NS\7 US gS tSe SS7 S[ S` SI S\ S3 T| (T`5 (?T_ NTJ ]T` kTl }T@ ,Tc[ TB T@ T{  Tt, U'0 %U5 AUp SU nU  }UN7F U29) U0 U <U?] U U{ VSG V38 :VIg LV` ,hVn V\H VɅA V"n= V V/t7 Vg VP V Wo  W 2W  @W2 WWUo nWI4 |Wu W ,W:9 W  WlV WWA WWc !X>ez 0XEl ?XL VXj lXT }X~ X& X Xn  )+ ,\,t?A A `F d  T  `7 X XX2P8 YI8 Y_# 1YFK* ?YQ* QYDc? kYK# yY*YYYpYlY4YCQ1 YR1 Y1ZZ^# )ZXZ 6Z`# JZ\J YZl* lZZZG# ZP1 ZZRG# ZoM* ZfM ["[j# =[[# K[e8 _[lJ2 o[TQ [jP1 [[fM [W# [ [ [G# \YS \ #\Mk? ?\^B R\W# n\n]* {\g\\N1 \XZ \J1 \p\ c8 \Z; ]P? ]l&]zl# 9]-J]I\]/G# k]S* ]I8 ]b1 ] ^m ]a? ]a# ]J* ]J* ]m# ^m* ^A(^f\S 5^TQ H^a^gO t^L* ^3[B ^p^M* ^JjT ^8^M* ^V# _8_J* *_n# 9_M? G_eL# T_d_-S* x_8_ia8 _ L* _O8 _U8 _O1 _2o# _DUQ ``l+`:D`FR* Y`fM r`b8 `7m* `U`\d# `ij ``k* `Bb> avH? aUX %a(7a4XZ Ga_Q Va`# kan# ~aa1 aam# aH8 ax^# akaa7b.b#k* /bAbZZX Sbc1 ibc* zb"bfM bL# bX_8 bBYQ biI# bbpcN1 c0cR1 @c4]: Nc Q8 \chq kc G# ycj* cZ# c\# cpR* c>ccm* cl# dIJ# d! dd? 4dPJdL# Xdl* edAN8 udQ* d X* ddN? dk* dG* d8eee2$e%VX :eMepK# [eke1I8 eSa en9 eZe_e? eT# ehj eeW_ fHD f`* $fi1 7fI# Ffd? Zf4L1 lfzn# fc* fQ# fZ# f+d1 fe8 fV# g'`* gd# (g;gb1 Rg#K# cgugV g6O1 gk* gR* gn9 glgQ`* gBgS hm# hah-hc# Bh:Vh_# hh[Z uhhhZ3hm# h8h8h e? h}V# ihQ (iWS* :igO1 Jij8 eiL# vii_X ib# i-iP1 iH6 iyN# iN8 iEij j1a8 j l# /jGAjK# PjobjmjAn9 jS* j,jR1 j\X ju[* j>H8 j"jPl* ktQ1 kK1 &kEM* 4k-l# @kYC PkuG# gk)Z1 sk{`# k]s k>__CTOR_LIST____DTOR_LIST____JCR_LIST____do_global_dtors_auxcompleted.5958p.5956frame_dummy__CTOR_END____DTOR_END____FRAME_END____JCR_END____do_global_ctors_aux__FUNCTION__.5795gpg_errorgpg_err_make__FUNCTION__.6465__FUNCTION__.6472gcry_errorgcry_err_make__FUNCTION__.6845__FUNCTION__.6865__FUNCTION__.6876__FUNCTION__.6892verbosity_levelfatal_error_handlerfatal_error_handler_valuelog_handlerlog_handler_valueuser_gettext_handlerwrite2stderr__FUNCTION__.6081__FUNCTION__.6125_gcry_logv__FUNCTION__.6510global_initany_init_doneforce_fips_modeparse_version_numberparse_version_stringC.23.6663print_configinit_finished.6689no_secure_memorydebug_flagsgpg_err_make_from_errnoalloc_funcalloc_secure_funcis_secure_funcrealloc_funcfree_funcoutofcore_handleroutofcore_handler_valueget_no_secure_memorydo_malloc.L72.L73.L71.L74.L75.L76.L77.L109.L79.L80.L81.L82.L83.L84.L85.L86.L87.L88.L89.L90.L91.L92.L93.L94.L95.L96.L97.L98.L99.L100.L101.L102.L103.L104.L105.L106.L107dump_stringnormalizesexp_sscan__FUNCTION__.5719__FUNCTION__.5725__FUNCTION__.5731__FUNCTION__.5738__FUNCTION__.5745__FUNCTION__.5759get_internal_buffer__FUNCTION__.5923sexp_nth_datahextobytemake_spaceunquote_string__FUNCTION__.6538tokenchars.6480whitespacepsuitable_encodingconvert_to_hexconvert_to_stringconvert_to_token__FUNCTION__.7505empty.7476.L322.L321.L323.L324.L325.L326.L327.L328.L329.L330.L331.L332.L333.L402.L401.L403.L404.L405.L406.L646.L647.L648.L649.L650.L651.L645.L652.L653.L654hw_featuresdetect_ia32_gnucuse_m_guardptr_into_pool_ppoolpool_sizestats_updatecur_allocedcur_blocksmb_get_nextmb_get_prevmb_mergemb_get_newprint_warnno_warninglock_poolshow_warningnot_lockedinit_pooldisable_secmempool_is_mmappedpool_okaysecmem_locksuspend_warningsecmem_init_gcry_secmem_malloc_internal_gcry_secmem_free_internal_gcry_module_id_new_gcry_module_dropfsm_lockprocfname.6254__FUNCTION__.6252done.6250fips_new_stateno_fips_mode_requiredenforced_fips_modelock_fsmunlock_fsm__FUNCTION__.6357inactive_fips_modestate2strcurrent_statereporteralgos.6495run_cipher_selftestsalgos.6521run_digest_selftestsalgos.6547run_hmac_selftestsalgos.6573run_pubkey_selftestsrun_random_selftestscheck_binary_integrity.L64.L65.L66.L67.L68.L69.L70.L223.L224.L225.L226.L227.L228K.3359transformrorfinalizecheck_init_lockops_setopsmutex_init__PRETTY_FUNCTION__.4111__PRETTY_FUNCTION__.4135__PRETTY_FUNCTION__.4153cipher_tabledummy_extra_specciphers_registered_lockdummy_setkey__FUNCTION__.5784dummy_encrypt_block__FUNCTION__.5790dummy_decrypt_block__FUNCTION__.5797dummy_encrypt_stream__FUNCTION__.5804dummy_decrypt_stream__FUNCTION__.5814cipher_register_defaultciphers_registeredgcry_cipher_lookup_func_namegcry_cipher_lookup_func_oidgcry_cipher_lookup_namegcry_cipher_lookup_oidsearch_oiddefault_ciphers_registeredcipher_algo_to_stringdisable_cipher_algocheck_cipher_algocipher_get_keylencipher_get_blocksizecipher_setkey__FUNCTION__.6321cipher_setivcipher_resetdo_ecb_encryptdo_ecb_decryptdo_cbc_encryptdo_cbc_decryptdo_cfb_encryptdo_cfb_decryptdo_ofb_encryptdo_ofb_decryptdo_ctr_encryptdo_ctr_decrypt__FUNCTION__.7120cipher_encrypt__FUNCTION__.7223cipher_decryptcipher_sync__FUNCTION__.7395.L167.L168.L169.L407.L408.L409.L410.L411.L412.L413.L451.L452.L453.L454.L455.L456.L457.L507.L508.L509.L510.L511.L512.L513.L514.L515.L516.L517pubkey_tablepubkeys_registered_lock__FUNCTION__.5914dummy_generate__FUNCTION__.5921dummy_check_secret_key__FUNCTION__.5931dummy_encrypt__FUNCTION__.5941dummy_decrypt__FUNCTION__.5950dummy_sign__FUNCTION__.5963dummy_verify__FUNCTION__.5970dummy_get_nbits__FUNCTION__.5981pk_register_defaultpubkeys_registeredgcry_pk_lookup_func_namegcry_pk_lookup_namerelease_mpi_arraydefault_pubkeys_registereddisable_pubkey_algocheck_pubkey_algopubkey_get_npkeypubkey_get_nskeypubkey_get_nsigpubkey_get_nencpubkey_generatepubkey_check_secret_keypubkey_encryptpubkey_decryptpubkey_signpubkey_verifysexp_elements_extract__FUNCTION__.6673sexp_elements_extract_eccsexp_to_keysexp_to_sigsexp_to_enchashnames.7016__FUNCTION__.7001sexp_data_to_mpi__FUNCTION__.7341__FUNCTION__.7463__FUNCTION__.7541__FUNCTION__.7753.L763.L762.L764.L765.L766.L767.L768ac_flagsac_key_identifiersac_data_values_destroyac_data_mpi_copy_gcry_ac_data_dump__FUNCTION__.6461__FUNCTION__.6523_gcry_ac_io_write__FUNCTION__.6589_gcry_ac_io_read_gcry_ac_io_read_all_gcry_ac_io_processac_data_extractac_data_constructem_randomize_nonzeroeme_pkcs_v1_5_encodeeme_pkcs_v1_5_decodeemsa_pkcs_v1_5_encode_data_cbemsa_pkcs_v1_5_encodeC.176.7721ac_data_dencodeac_es_dencode_prepare_pkcs_v1_5ac_ssa_dencode_prepare_pkcs_v1_5ac_schemesac_scheme_getac_dencode_prepareac_data_set_to_mpidigest_tabledigests_registered_lock__FUNCTION__.5800md_register_defaultdigests_registeredgcry_md_lookup_func_namegcry_md_lookup_func_oidgcry_md_lookup_namegcry_md_lookup_oiddefault_digests_registereddigest_algo_to_stringcheck_digest_algomd_openmd_closemd_enable__FUNCTION__.6203md_copymd_writemd_start_debugmd_stop_debug__FUNCTION__.6382md_finalmd_get_algomd_readmd_digest_length__FUNCTION__.6489prepare_macpadsgcry_err_codegpg_err_code__FUNCTION__.6601__FUNCTION__.6639__FUNCTION__.6682md_asn_oididx.6803check_oneselftests_sha1tv.5740selftests_sha224tv.5779selftests_sha256tv.5844selftests_sha384tv.5883selftests_sha512run_selftestssmall_prime_numbersno_of_small_prime_numbersprimepool_locksave_pool_prime__FUNCTION__.5957get_pool_primeprogress_cbprogress_cb_dataprogressgen_primeprime_generate_internalm_out_of_ncheck_primeis_prime__FUNCTION__.6689__FUNCTION__.6763find_x931_prime__FUNCTION__.7297do_encrypt_streamencrypt_streamselftest_failed.5679initialized.5678do_arcfour_setkeyselftestarcfour_setkeyciphertext_1.5750plaintext_1.5749key_1.5748ks0ks1ks2ks3psdo_encryptdecryptdo_encrypt_blockencrypt_blockdo_decrypt_blockdecrypt_blockbf_setkeyselftest_failed.7151initialized.7150do_bf_setkeys1s2s3s4s5s6s7s8rolcast_setkeykey_scheduleselftest_failed.7331initialized.7330do_cast_setkeysbox1sbox2sbox3sbox4sbox5sbox6sbox7sbox8leftkey_swaprightkey_swapencrypt_rotate_tabweak_keysweak_keys_chksumdes_key_scheduleselftest_failed.5937des_setkeyinitializeddes_ecb_crypttripledes_set2keysselftest_failed.6507tripledes_set3keystripledes_ecb_cryptis_weak_keyC.24.7929do_tripledes_setkeydo_tripledes_set_extra_infodo_tripledes_encryptdo_tripledes_decryptdo_des_setkeydo_des_encryptdo_des_decryptselftest_fipsoids_tripledesST1T2T3T4T5T6T7T8S5U1U2U3U4rconselftest_failed.5645initialized.5644do_setkeyrijndael_setkeyprepare_decryptiondo_encrypt_aligneddo_padlockrijndael_encryptdo_decrypt_aligneddo_decryptrijndael_decryptciphertext_128.7459key_128.7458plaintext_128.7457selftest_basic_128ciphertext_192.7475key_192.7474plaintext_192.7473selftest_basic_192ciphertext_256.7491key_256.7490plaintext_256.7489selftest_basic_256__FUNCTION__.7531C.84.7538selftest_fips_128_38aselftest_fips_128selftest_fips_192selftest_fips_256rijndael_namesrijndael_oidsrijndael192_namesrijndael192_oidsrijndael256_namesrijndael256_oidsq0q1mdspoly_to_expexp_to_polycalc_sb_tblselftest_failed.5649initialized.5648do_twofish_setkeytwofish_setkeydo_twofish_encrypttwofish_encryptdo_twofish_decrypttwofish_decryptciphertext_256.12580key_256.12579plaintext_256.12578ciphertext.12577key.12576plaintext.12575serpent_key_prepareserpent_subkeys_generateserpent_setkey_internalserpent_init_done.7317serpent_test_ret.7316serpent_setkeyserpent_testserpent_encrypt_internalserpent_decrypt_internalserpent_encryptserpent_decrypttest_data.12985cipher_spec_serpent128_aliasesrfc2268_sboxselftest_failed.5957initialized.5956setkey_coreciphertext_3.6076plaintext_3.6075key_3.6074ciphertext_2.6073plaintext_2.6072key_2.6071ciphertext_1.6070plaintext_1.6069key_1.6068oids_rfc2268_40SS0SS1SS2SS3KCselftest_failed.5627initialized.5626seed_setkeyseed_encryptseed_decryptciphertext.8061key.8060plaintext.8059seed_oidscamellia_sp1110camellia_sp0222camellia_sp3033camellia_sp4404selftest_failed.5636initialized.5635camellia_setkeycamellia_encryptcamellia_decryptciphertext_256.5687key_256.5686ciphertext_192.5685key_192.5684ciphertext_128.5683key_128.5682plaintext.5681camellia128_oidscamellia192_oidscamellia256_oidssample_secret_keysample_public_keygen_ktest_keyssignverify__FUNCTION__.5936generate__FUNCTION__.6084generate_fips186check_secret_keydsa_generate_extdsa_generatedsa_check_secret_keydsa_signdsa_verifydsa_get_nbitssample_data_bad.6673sample_data.6672selftest_sign_1024selftests_dsadsa_namespublicsecretcheck_exponent__FUNCTION__.5863generate_std__FUNCTION__.5942gen_x931_parm_xp__FUNCTION__.5955gen_x931_parm_xi__FUNCTION__.6004generate_x931rsa_blindrsa_unblindrsa_generate_extrsa_generatersa_check_secret_keyrsa_encryptrsa_decryptrsa_signrsa_verifyrsa_get_nbitscompute_keygripsample_data_bad.6480sample_data.6479extract_a_from_sexpselftest_encr_1024selftests_rsarsa_namest.5847wiener_map__FUNCTION__.5930__FUNCTION__.5994generate_using_xelg_generate_extelg_generateelg_check_secret_keyelg_encryptelg_decryptelg_signelg_verifyelg_get_nbitselg_namescurve_aliasesdomain_parmspoint_setcurve_freecurve_copyscanvalgen_y_2generate_curvegenerate_keyec2osos2ececc_generate_extecc_generateecc_get_paramecc_check_secret_keyecc_signecc_verifyecc_get_nbitsnames.6717selftests_ecdsaecdsa_namescrc32_tableupdate_crc32crc32_initcrc32_writecrc32_readcrc32_finalcrc32rfc1510_initcrc32rfc1510_finalcrc24rfc2440_initcrc24rfc2440_writecrc24rfc2440_finalmd4_initmd4_writemd4_finalmd4_readasnoid_spec_md4md5_initmd5_writemd5_finalmd5_readoid_spec_md5sha256_initsha224_initK.5652sha256_writesha256_finalsha256_readasn224oid_spec_sha224asn256oid_spec_sha256sha512_initsha384_initk.5662sha512_writesha512_finalsha512_readsha512_asnoid_spec_sha512sha384_asnoid_spec_sha384tiger_inittiger_roundpasstiger_writetiger_finaltiger_readoid_spec_tigerrcC0C1C2C3C4C5C6C7whirlpool_initwhirlpool_transform__FUNCTION__.6417whirlpool_addwhirlpool_writewhirlpool_finalwhirlpool_readrmd160_writermd160_finalrmd160_readoid_spec_rmd160sha1_initsha1_writesha1_finalsha1_readoid_spec_sha1do_randomizepool_locknonce_buffer_lock__FUNCTION__.7100initialized.7098initialize_basicspool_is_lockedunlock_poolinitializerndpoolsecure_allockeypoolgetfnc_gather_randomslow_gather_fncfaked_rnggather_fakedgetfnc_fast_random_pollfast_gather_fncrndstatsquick_testadd_randomnessread_pool__FUNCTION__.7274failsafe_digest_valid.7267failsafe_digest.7266mix_pool__FUNCTION__.7324seed_file_namelock_seed_file__FUNCTION__.7368read_seed_fileallow_seed_file_updateread_random_sourcepool_filled__FUNCTION__.7525my_pid.7523just_mixeddid_initial_extra_seedingpool_balancerandom_polldo_fast_random_pollpool_readpos__FUNCTION__.7645pool_writepospool_filled_counter__FUNCTION__.7729initialized.7775__FUNCTION__.7812my_pid.7805nonce_buffer_initialized.7804nonce_buffer.7803fips_rng_lock__FUNCTION__.6425initialized.6423basic_initializationfips_rng_is_lockedlock_rngunlock_rngsetup_guardscheck_guardscounter2.6474counter0.6473counter1.6472last_usec.6471last_sec.6470__FUNCTION__.6469x931_get_dtnonce_contextstd_rng_contextstrong_rng_contextxor_buffer__FUNCTION__.6628encrypt_aesx931_aes__FUNCTION__.6663x931_aes_drivertempvalue_for_x931_aes_driverx931_reseed__FUNCTION__.6728entropy_collect_cbentropy_collect_bufferentropy_collect_buffer_lenentropy_collect_buffer_size__FUNCTION__.6758get_entropy__FUNCTION__.6779x931_generate_keyget_random__FUNCTION__.6811x931_generate_seed__FUNCTION__.6826__FUNCTION__.6844__FUNCTION__.6880__FUNCTION__.6958tv.6951selftest_katpoll_padlockrng_failedset_cloexec_flagopen_devicefd_random.6602fd_urandom.6601__FUNCTION__.5884build_index__FUNCTION__.5876mpi_read_from_buffermpi_fromstrdo_get_buffer__FUNCTION__.6108gpg_error_from_syserrormul_n_basecasemul_nmod_source_info__FUNCTION__.5990mpi_set_secureec_addmec_submec_mulmec_powmec_invmLoopL0LendL1Lend2L2Loop2_gcry_register_pk_elg_progress_gcry_mpi_alloc_set_ui_gcry_ac_key_data_get_gcry_sexp_sscan_gcry_digest_spec_sha256_gcry_digest_spec_md5_gcry_mpi_clear_bit_gcry_mpi_ec_point_init_gcry_hmac256_release_gcry_set_fatalerror_handler_gcry_pk_ctl_gcry_rngcsprng_fast_poll_gcry_mpi_cmp_gcry_rngfips_is_faked_gcry_sexp_vlist_gcry_assert_failed_gcry_cipher_setiv_gcry_randomize_gcry_md_is_enabledac_key_generate_specs_gcry_mpi_fdiv_q_gcry_mpi_lshift_limbs_gcry_ath_install_gcry_set_log_handler_gcry_log_gcry_cipher_encrypt_gcry_hmac256_finalize_gcry_pubkey_spec_rsa_gcry_calloc_gcry_secmem_malloc_gcry_digest_extraspec_sha384_gcry_xrealloc_gcry_cipher_info_gcry_cipher_spec_serpent256_gcry_derive_x931_prime_gcry_register_pk_ecc_progress_gcry_fips_test_operational_gcry_rngcsprng_set_seed_file_gcry_camellia_setup192_gcry_mpih_mod_1_gcry_ac_data_to_sexp_gcry_mpi_get_opaque_gcry_module_list_gcry_cipher_decrypt_gcry_rngcsprng_update_seed_file_gcry_pk_map_name_gcry_pk_module_lookup_gcry_check_version_gcry_ath_mutex_destroy_gcry_mpi_alloc_gcry_mpi_get_nbits_gcry_mpi_mulm_gcry_set_log_verbosity_gcry_ac_io_init_va_gcry_module_lookup_gcry_random_initialize_gcry_ath_mutex_unlock_gcry_ac_key_destroy_gcry_err_code_to_errno_gcry_mpi_resize_gcry_aes_cbc_enc_gcry_prime_group_generator_gcry_sexp_nth_string_gcry_initialize_fips_mode_gcry_md_enable_gcry_mpi_trailing_zeros_gcry_pk_get_nbits_gcry_digest_spec_sha384_gcry_mpih_sqr_n_basecase_gcry_set_gettext_handler_gcry_ac_data_get_index_gcry_rngcsprng_is_faked_gcry_random_run_external_test_gcry_ath_write_gcry_fips_is_operational_gcry_sexp_car_gcry_mpi_alloc_limb_space_gcry_prime_release_factors_gcry_pk_register_gcry_digest_spec_crc32_gcry_mpi_barrett_init_gcry_ac_key_test_gcry_mpih_sub_1_gcry_inactivate_fips_mode_gcry_sexp_cadr_fini__fstat_gcry_fips_mode_gcry_set_random_seed_file_gcry_mpi_swap_gcry_mpi_release_gcry_pk_algo_name_gcry_mpi_snew_gcry_log_fatal_gcry_sexp_cons_gcry_ath_mutex_init_gcry_strsource_gcry_set_progress_handler_gcry_ac_mpi_to_os_alloc_gcry_secmem_get_flags_gcry_module_add_gcry_mpi_normalize_gcry_check_heap_gcry_sexp_nth_gcry_err_make_from_errno_gcry_digest_spec_crc32_rfc1510_gcry_mpi_tdiv_qr_gcry_register_primegen_progress_gcry_mpih_add_n_gcry_cipher_extraspec_tripledes_gcry_mpih_submul_1_gcry_xcalloc_secure_gcry_log_info_with_dummy_fp_gcry_realloc_gcry_rngcsprng_enable_quick_gen_gcry_sexp_create_gcry_camellia_setup128_GLOBAL_OFFSET_TABLE__gcry_mpi_mul_2exp_gcry_mpi_ec_free_gcry_mpi_print_gcry_pk_testkey_gcry_sexp_release_gcry_log_debug_gcry_mpi_tdiv_r_gcry_ac_key_pair_destroy_gcry_sexp_build_array_gcry_xstrdup_gcry_cipher_get_algo_keylen_gcry_cipher_spec_aes256_gcry_set_allocation_handler_gcry_rngfips_create_nonce_gcry_sexp_sprint_gcry_cipher_init_gcry_md_write_gcry_camellia_encrypt128_gcry_rngfips_add_bytes_gcry_rngcsprng_dump_stats_gcry_malloc_secure_gcry_cipher_ctl_gcry_mpi_ec_get_affine_gcry_secmem_term_gcry_mpi_set_gcry_cipher_spec_camellia192_gcry_rngcsprng_create_nonce_gcry_generate_elg_prime_gcry_camellia_decrypt128_gcry_fips_run_selftests_gcry_digest_extraspec_sha512_gcry_module_use_gcry_ath_recvmsg_gcry_bug_gcry_ac_key_get_nbits_gcry_ac_io_init_gcry_private_check_heap_gcry_burn_stack_gcry_generate_fips186_2_prime_gcry_pk_get_keygrip_gcry_mpi_clear_gcry_cipher_spec_serpent192_gcry_rngfips_initialize_gcry_mpi_alloc_like_gcry_rngcsprng_initialize_gcry_mpi_sub_ui_gcry_digest_spec_crc24_rfc2440_gcry_mpi_get_buffer_gcry_cipher_spec_rfc2268_40_gcry_is_fips_mode_inactive_gcry_sexp_dump_gcry_mpi_gcd_gcry_ac_data_verify_scheme_gcry_Camellia_DecryptBlock_gcry_mpi_ec_mul_point_gcry_rngcsprng_secure_alloc_gcry_cipher_spec_serpent128_gcry_mpi_ec_init_gcry_ath_accept_gcry_mpi_get_hw_config_gcry_generate_fips186_3_prime_gcry_mpi_alloc_secure_gcry_mpih_divmod_1_gcry_mpi_sub_gcry_cipher_map_name_gcry_hmac256_update_gcry_pk_encryptprimepool_gcry_secmem_init_gcry_update_random_seed_file_gcry_pk_verify_gcry_ac_data_from_sexp_gcry_set_outofcore_handler_gcry_camellia_decrypt256_gcry_mpi_mul_ui_gcry_sha1_hash_buffer_gcry_ath_select_gcry_mpi_set_buffer_gcry_pk_algo_info_gcry_ac_data_get_name_gcry_secmem_dump_stats_gcry_ac_data_new_gcry_mpi_clear_highbit_gcry_fips_noreturn_gcry_rngfips_dump_statsgcry_ac_data_dump_gcry_cipher_algo_name_gcry_module_release_gcry_mpi_cmp_ui_gcry_md_get_algo_dlen_gcry_ac_key_pair_extract_gcry_random_deinit_external_test_gcry_mpi_subm_gcry_cipher_spec_camellia128_gcry_mpih_sub_gcry_random_progress_gcry_xmalloc_secure_gcry_digest_extraspec_sha256_gcry_random_bytes_secure_gcry_ath_waitpid_gcry_sexp_append_gcry_mpih_lshift_gcry_private_is_secure_gcry_rndhw_failed_p_gcry_mpi_get_flag_gcry_md_init_gcry_mpi_tdiv_q_2exp_gcry_ac_data_sign_gcry_mpih_mul_n_gcry_mpi_assign_limb_space_gcry_xmalloc_gcry_cipher_setctr_gcry_ac_key_get_grip_gcry_random_bytes_gcry_mpi_clear_flag_gcry_cipher_register__dso_handle_gcry_sexp_alist_gcry_prime_generate_gcry_cipher_extraspec_aes_gcry_cipher_spec_aes192_gcry_md_close_gcry_Camellia_Ekeygen_gcry_mpih_addmul_1_gcry_mpi_scan_gcry_hmac256_file_gcry_secmem_free_gcry_random_add_bytes_gcry_gettext_gcry_cipher_spec_twofish128_gcry_mpi_dump_gcry_log_error_gcry_generate_secret_prime_gcry_mpi_mulpowm_gcry_enforced_fips_mode_gcry_rmd160_hash_buffer_gcry_ac_data_verify_gcry_sexp_vbuild_gcry_fast_random_poll_gcry_md_map_name_gcry_digest_spec_rmd160_gcry_pk_module_release_gcry_mpi_randomize_gcry_mpi_set_highbit_gcry_mpih_divrem_gcry_log_info_gcry_cipher_spec_twofish_gcry_aes_cbc_decgcry_mpi_get_ui_gcry_pubkey_extraspec_ecdsa_gcry_md_selftest_gcry_mpih_mul_1_gcry_cipher_spec_arcfour_gcry_private_free_gcry_random_init_external_test_gcry_mpih_release_karatsuba_ctx_gcry_get_hw_features_gcry_mpih_sqr_n_gcry_md_copy_gcry_mpih_sub_n_gcry_md_setkey_gcry_module_lookup_id_gcry_mpi_fdiv_qr_gcry_camellia_setup256_gcry_md_register_gcry_mpi_set_ui_gcry_mpi_set_bit_gcry_mpi_mul_gcry_enable_quick_random_gen_gcry_hmac_selftest__bss_start__i686.get_pc_thunk.cx_gcry_mpih_cmp_gcry_md_algo_info_gcry_mpi_rshift_gcry_ath_connect_gcry_md_read_gcry_md_unregister_gcry_pk_init_gcry_sexp_prepend_gcry_log_printhex_gcry_mpi_putbyte_gcry_random_dump_stats_gcry_md_hash_buffer_gcry_digest_spec_whirlpool_gcry_cipher_open_gcry_mpi_new_gcry_digest_extraspec_sha224_gcry_pk_selftest_gcry_strerror_gcry_sexp_find_token_gcry_pubkey_spec_elg_gcry_digest_spec_sha512_gcry_sexp_cdr_gcry_mpi_ec_add_points_gcry_md_debug_gcry_rngcsprng_add_bytes_gcry_is_secure_gcry_rngcsprng_set_daemon_socket_gcry_mpi_powm_gcry_mpi_fdiv_r_ui_gcry_ac_data_decrypt_scheme_gcry_sexp_length_gcry_pk_decrypt_gcry_mpi_test_bit_gcry_free_gcry_error_from_errno_gcry_md_get_gcry_digest_spec_tiger_gcry_register_random_progress_gcry_mpi_add_gcry_md_info_gcry_mpi_aprint_gcry_ac_key_init_gcry_private_malloc_gcry_digest_spec_md4_gcry_private_realloc_gcry_ac_data_sign_scheme_gcry_ath_mutex_lock_gcry_mpi_mod_gcry_cipher_list_gcry_private_enable_m_guard_gcry_sexp_new_gcry_random_is_faked_gcry_cipher_spec_blowfish_gcry_ac_data_set_gcry_register_pk_dsa_progress_gcry_md_reset_gcry_mpi_fdiv_r_gcry_secure_random_alloc_gcry_cipher_spec_des_end_gcry_sexp_nth_data_gcry_cipher_extraspec_aes256_gcry_use_random_daemon_gcry_ac_data_decode_gcry_mpi_m_check_gcry_hash_selftest_check_one_gcry_ac_data_encrypt_gcry_ac_data_copy_gcry_pk_sign_gcry_pk_get_elements_gcry_mpi_ec_dup_point_gcry_prime_check_gcry_global_is_operational_gcry_aes_cfb_dec_gcry_cipher_spec_seed_gcry_ac_data_clear_gcry_rndhw_poll_fast_gcry_random_selftest_gcry_camellia_encrypt256fstat_gcry_cipher_extraspec_aes192_gcry_rmd160_init_gcry_md_open_gcry_mpih_add_1_gcry_vcontrol_gcry_cipher_selftest_gcry_secmem_realloc_gcry_digest_spec_sha224_gcry_pk_unregister_gcry_rngcsprng_randomize_gcry_pubkey_spec_ecdsa_gcry_mpi_get_ui_gcry_ac_os_to_mpi_gcry_md_is_secure_gcry_rngcsprng_use_daemon_gcry_mpi_mul_barrett_gcry_ac_data_encrypt_scheme_gcry_mpi_set_opaque_gcry_cipher_close_gcry_ac_data_encode_gcry_rngfips_deinit_external_test_gcry_log_verbosity_gcry_set_random_daemon_socket_gcry_err_code_from_errno_gcry_mpi_ec_point_free_gcry_cipher_unregister_gcry_rndlinux_gather_random_gcry_cipher_setkey_gcry_Camellia_EncryptBlock_gcry_ac_data_decrypt_gcry_rndhw_poll_slow_gcry_mpi_divisible_ui_gcry_ath_init_gcry_md_get_algo_gcry_md_list_gcry_ac_mpi_to_os_gcry_mpi_rshift_limbs_gcry_pk_aliased_algo_name_gcry_rngfips_init_external_test_gcry_log_printf_gcry_cipher_spec_cast5_edata_gcry_mpih_rshift_gcry_strdup_gcry_sexp_build_gcry_ac_close_gcry_mpih_mul_karatsuba_case_gcry_sexp_nth_mpi_gcry_aes_cfb_enc_gcry_pubkey_extraspec_rsa_gcry_ac_key_pair_generate_gcry_pubkey_extraspec_elg_gcry_digest_spec_sha1_gcry_mpih_mul_gcry_mpi_addm_gcry_ac_open_gcry_ath_sendmsg_gcry_cipher_spec_camellia256_gcry_mpi_free_limb_space_gcry_generate_public_prime_gcry_md_algo_name_gcry_cipher_mode_from_oid_gcry_malloc_gcry_detect_hw_features_gcry_digest_extraspec_sha1_gcry_fatal_error_gcry_pubkey_extraspec_dsa_gcry_mpih_add_gcry_log_mpidump_gcry_mpi_get_secure_buffer_gcry_mpi_getbyte_gcry_pubkey_spec_dsa_gcry_pk_list_gcry_sexp_canon_len_gcry_calloc_secure_gcry_create_nonce_gcry_cipher_get_algo_blklen_gcry_hmac256_new_gcry_cipher_spec_tripledes_gcry_rngfips_randomize_gcry_mpi_invm_gcry_ac_data_destroy_gcry_mpi_set_flag_gcry_md_ctl_gcry_log_bug_gcry_mpi_copy_gcry_xcalloc_gcry_mpi_mod_barrett_gcry_pk_genkey_gcry_private_malloc_secure_gcry_mpi_div_gcry_cipher_algo_info__i686.get_pc_thunk.bx_gcry_ac_init_gcry_mpi_lshift_gcry_cipher_spec_aes_gcry_get_debug_flag_gcry_ac_data_length_gcry_rngfips_run_external_test_DYNAMIC_init_gcry_fips_test_error_or_operational_gcry_mpi_free_gcry_ath_read_gcry_rngfips_selftest_gcry_rmd160_mixblock_gcry_mpi_add_ui_gcry_secmem_set_flags_gcry_control_gcry_fips_signal_error_gcry_mpi_barrett_freeabort@@GLIBC_2.0__errno_location@@GLIBC_2.0gcry_mpi_mulmgcry_sexp_canon_lengcry_md_map_namegcry_sexp_nthgcry_mpi_test_bitgcry_ac_key_pair_generategcry_sexp_cdrsprintf@@GLIBC_2.0srand@@GLIBC_2.0open@@GLIBC_2.0connect@@GLIBC_2.0mmap@@GLIBC_2.0gcry_mpi_gcdgcry_mpi_set_opaquegetpid@@GLIBC_2.0strerror@@GLIBC_2.0gcry_md_is_securegcry_pk_signgcry_ac_data_lengthgcry_md_enablegcry_calloc_securesysconf@@GLIBC_2.0memcmp@@GLIBC_2.0gcry_error_from_errnogcry_mpi_mul_uisyslog@@GLIBC_2.0gcry_err_code_from_errnogcry_mpi_cmpgcry_ac_data_verify_schemegpg_err_code_from_errnogcry_prime_release_factorsgcry_md_closegcry_ac_data_verifygcry_sexp_vlistgcry_cipher_setivgcry_mpi_mul_2expgcry_ac_data_decrypt_schemegcry_cipher_get_algo_keylen__gmon_start___Jv_RegisterClassesgcry_check_versiongcry_pk_genkeyrealloc@@GLIBC_2.0gcry_set_allocation_handlergcry_md_is_enabledgcry_cipher_get_algo_blklengcry_md_readstrchr@@GLIBC_2.0strncpy@@GLIBC_2.0gcry_mpi_addgcry_pk_decryptgcry_sexp_find_tokenwrite@@GLIBC_2.0gcry_ac_key_initgcry_pk_get_nbitsgcry_mpi_divsendmsg@@GLIBC_2.0gcry_malloc_securefgets@@GLIBC_2.0memset@@GLIBC_2.0gcry_strsourcegcry_mpi_clear_flaggcry_sexp_sprintgcry_ac_opengcry_md_get_algogcry_ac_data_get_indexgcry_ac_data_cleargcry_sexp_prependgcry_sexp_appendgcry_xmallocgcry_xreallocstpcpy@@GLIBC_2.0gcry_md_copygcry_cipher_setkey__assert_fail@@GLIBC_2.0gcry_ac_name_to_idgcry_mpi_setgcry_pk_get_keygripread@@GLIBC_2.0gcry_mpi_cmp_uigcry_prime_generategetrusage@@GLIBC_2.0gcry_mpi_set_uigcry_cipher_map_namegettimeofday@@GLIBC_2.0gcry_sexp_consgcry_is_securegcry_mpi_scangcry_mpi_newfree@@GLIBC_2.0gcry_mpi_get_opaqueaccess@@GLIBC_2.0gcry_ac_data_get_namegcry_sexp_nth_stringgcry_mpi_submgcry_cipher_infogcry_mpi_mulgcry_md_unregistergcry_cipher_setctrfflush@@GLIBC_2.0accept@@GLIBC_2.0__ctype_b_loc@@GLIBC_2.3gcry_mpi_set_highbitgcry_ac_data_sign_schemegcry_ac_io_init_vagcry_xcallocgpg_strsourcegcry_ac_key_destroygcry_create_noncefclose@@GLIBC_2.1gcry_set_fatalerror_handlergcry_ac_io_initgcry_sexp_creategcry_cipher_ctlsetuid@@GLIBC_2.0gcry_pk_encryptgcry_md_setkeygcry_ac_data_destroygcry_pk_unregistergcry_ac_data_to_sexpgcry_xmalloc_securegcry_sexp_sscangcry_md_get_algo_dlenclock@@GLIBC_2.0stderr@@GLIBC_2.0memcpy@@GLIBC_2.0strtoul@@GLIBC_2.0gcry_set_progress_handlerstrlen@@GLIBC_2.0gcry_pk_algo_infogcry_ac_key_get_nbitsgcry_ac_key_testfopen@@GLIBC_2.1gcry_ac_data_encrypt_schemegcry_mpi_copygcry_md_algo_infogcry_pk_verifygcry_sexp_releasegetppid@@GLIBC_2.0waitpid@@GLIBC_2.0gcry_mpi_add_uistrcpy@@GLIBC_2.0gcry_mpi_rshiftgcry_md_writegcry_mpi_powmgcry_randomizegcry_strerrorgcry_prime_checkgcry_pk_algo_namegcry_md_resetgcry_mpi_clear_highbitgetuid@@GLIBC_2.0gpg_strerrorgcry_xcalloc_securegcry_strdupgcry_sexp_alistatoi@@GLIBC_2.0gcry_ac_data_decodestrcasecmp@@GLIBC_2.0gcry_mpi_snewgcry_reallocgcry_mpi_aprintgcry_mpi_set_bitgcry_cipher_listselect@@GLIBC_2.0gcry_mpi_printgcry_set_outofcore_handlergcry_err_make_from_errnoftruncate@@GLIBC_2.0close@@GLIBC_2.0fwrite@@GLIBC_2.0gcry_cipher_algo_infofprintf@@GLIBC_2.0gcry_sexp_cartime@@GLIBC_2.0gcry_sexp_build_arraygcry_cipher_opengcry_md_registermalloc@@GLIBC_2.0gcry_ac_data_decryptgcry_cipher_closegcry_random_bytesgcry_cipher_decryptgcry_sexp_buildgcry_ac_data_copygcry_mpi_randomizegcry_sexp_dumpgcry_ac_data_encodegcry_sexp_nth_mpigcry_cipher_unregistergcry_ac_key_pair_extractgcry_mpi_get_nbitsgcry_pk_map_namegcry_ac_key_get_gripgcry_ac_data_signgcry_cipher_mode_from_oidgcry_md_debuggcry_ac_key_pair_destroymemmove@@GLIBC_2.0gcry_ac_data_from_sexpgcry_sexp_lengthstrcat@@GLIBC_2.0gcry_cipher_encryptgcry_mpi_subgcry_set_log_handlergcry_mpi_clear_bitgcry_pk_registerrecvmsg@@GLIBC_2.0gcry_md_listgcry_ac_id_to_namegcry_freefcntl@@GLIBC_2.0rand@@GLIBC_2.0gcry_ac_key_data_get__fxstat@@GLIBC_2.0gcry_md_algo_namegcry_md_openstrncmp@@GLIBC_2.0gpg_err_code_from_syserrorvfprintf@@GLIBC_2.0gcry_xstrdupmunmap@@GLIBC_2.0mlock@@GLIBC_2.0gcry_ac_data_encryptgcry_cipher_algo_namegcry_random_add_bytesgcry_mpi_set_flaggcry_mpi_sub_uigcry_prime_group_generatorgcry_mpi_releasefread@@GLIBC_2.0gcry_md_infogcry_ac_closesnprintf@@GLIBC_2.0gcry_mpi_modgcry_controlgcry_mpi_dumpgcry_mpi_addmgcry_random_bytes_securegcry_ac_data_setgcry_set_gettext_handlerstrdup@@GLIBC_2.0gcry_sexp_cadrferror@@GLIBC_2.0GCRYPT_1.2gcry_cipher_registergcry_mpi_get_flagstrcmp@@GLIBC_2.0gcry_mpi_lshiftgcry_md_ctlgcry_pk_listgcry_sexp_new__cxa_finalize@@GLIBC_2.1.3gcry_callocgcry_mpi_invmgcry_sexp_nth_datagcry_mpi_swapgcry_mallocgcry_pk_testkeygcry_err_code_to_errnogcry_pk_ctlgcry_ac_data_newgcry_md_hash_buffergeteuid@@GLIBC_2.0./libgcrypt-1.4.4-i686/usr/local/lib/libgcrypt.a0000644000000000000000000322317011237045206017666 0ustar rootroot! / 1249659526 0 0 0 17830 ` GhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhGhBBG0G0G0G0G0G0QQQQQQQQQnnnnnnvfvfvfvfvfvfvfvfvfvfvf>>>>>" "  > > > K K K K ]r ]r h h h h h h h h h h h h h h h & & & & & & & & & & & & & & & & & & & & & & & : : : : : : : : : : :  ^           1( 1( 1( 1( 1( 1( 1( 1( 1( R R ^` ^` ^` ^` ^` ^` f, f, f, f, f, f, r u2 u2 u2 { ~X ~X ~X ~X ~X ~X ~X ~X ~X ۊ > > > > V V        gcry_strerrorgcry_strsourcegcry_err_code_from_errnogcry_err_code_to_errnogcry_err_make_from_errnogcry_error_from_errnogcry_check_versiongcry_controlgcry_sexp_newgcry_sexp_creategcry_sexp_sscangcry_sexp_buildgcry_sexp_build_arraygcry_sexp_releasegcry_sexp_canon_lengcry_sexp_sprintgcry_sexp_dumpgcry_sexp_consgcry_sexp_alistgcry_sexp_vlistgcry_sexp_appendgcry_sexp_prependgcry_sexp_find_tokengcry_sexp_lengthgcry_sexp_nthgcry_sexp_cargcry_sexp_cdrgcry_sexp_cadrgcry_sexp_nth_datagcry_sexp_nth_stringgcry_sexp_nth_mpigcry_mpi_newgcry_mpi_snewgcry_mpi_releasegcry_mpi_copygcry_mpi_setgcry_mpi_set_uigcry_mpi_swapgcry_mpi_cmpgcry_mpi_cmp_uigcry_mpi_scangcry_mpi_printgcry_mpi_aprintgcry_mpi_dumpgcry_mpi_addgcry_mpi_add_uigcry_mpi_addmgcry_mpi_subgcry_mpi_sub_uigcry_mpi_submgcry_mpi_mulgcry_mpi_mul_uigcry_mpi_mulmgcry_mpi_mul_2expgcry_mpi_divgcry_mpi_modgcry_mpi_powmgcry_mpi_gcdgcry_mpi_invmgcry_mpi_get_nbitsgcry_mpi_test_bitgcry_mpi_set_bitgcry_mpi_clear_bitgcry_mpi_set_highbitgcry_mpi_clear_highbitgcry_mpi_rshiftgcry_mpi_lshiftgcry_mpi_set_opaquegcry_mpi_get_opaquegcry_mpi_set_flaggcry_mpi_clear_flaggcry_mpi_get_flaggcry_cipher_opengcry_cipher_closegcry_cipher_setkeygcry_cipher_setivgcry_cipher_setctrgcry_cipher_ctlgcry_cipher_infogcry_cipher_algo_infogcry_cipher_algo_namegcry_cipher_map_namegcry_cipher_mode_from_oidgcry_cipher_encryptgcry_cipher_decryptgcry_cipher_get_algo_keylengcry_cipher_get_algo_blklengcry_cipher_listgcry_pk_encryptgcry_pk_decryptgcry_pk_signgcry_pk_verifygcry_pk_testkeygcry_pk_genkeygcry_pk_ctlgcry_pk_algo_infogcry_pk_algo_namegcry_pk_map_namegcry_pk_get_nbitsgcry_pk_get_keygripgcry_pk_listgcry_md_opengcry_md_closegcry_md_enablegcry_md_copygcry_md_resetgcry_md_ctlgcry_md_writegcry_md_readgcry_md_hash_buffergcry_md_get_algogcry_md_get_algo_dlengcry_md_is_enabledgcry_md_is_securegcry_md_infogcry_md_algo_infogcry_md_algo_namegcry_md_map_namegcry_md_setkeygcry_md_debuggcry_md_listgcry_ac_data_newgcry_ac_data_destroygcry_ac_data_copygcry_ac_data_lengthgcry_ac_data_cleargcry_ac_data_setgcry_ac_data_get_namegcry_ac_data_get_indexgcry_ac_data_to_sexpgcry_ac_data_from_sexpgcry_ac_io_initgcry_ac_io_init_vagcry_ac_opengcry_ac_closegcry_ac_key_initgcry_ac_key_pair_generategcry_ac_key_pair_extractgcry_ac_key_data_getgcry_ac_key_testgcry_ac_key_get_nbitsgcry_ac_key_get_gripgcry_ac_key_destroygcry_ac_key_pair_destroygcry_ac_data_encodegcry_ac_data_decodegcry_ac_data_encryptgcry_ac_data_decryptgcry_ac_data_signgcry_ac_data_verifygcry_ac_data_encrypt_schemegcry_ac_data_decrypt_schemegcry_ac_data_sign_schemegcry_ac_data_verify_schemegcry_ac_id_to_namegcry_ac_name_to_idgcry_randomizegcry_random_add_bytesgcry_random_bytesgcry_random_bytes_securegcry_mpi_randomizegcry_create_noncegcry_prime_generategcry_prime_group_generatorgcry_prime_release_factorsgcry_prime_checkgcry_set_progress_handlergcry_set_allocation_handlergcry_set_outofcore_handlergcry_set_fatalerror_handlergcry_set_log_handlergcry_set_gettext_handlergcry_mallocgcry_callocgcry_malloc_securegcry_calloc_securegcry_reallocgcry_strdupgcry_xmallocgcry_xcallocgcry_xmalloc_securegcry_xcalloc_securegcry_xreallocgcry_xstrdupgcry_freegcry_is_securegcry_cipher_registergcry_cipher_unregistergcry_pk_registergcry_pk_unregistergcry_md_registergcry_md_unregister_gcry_set_gettext_handler_gcry_gettext_gcry_set_fatalerror_handler_gcry_fatal_error_gcry_set_log_handler_gcry_set_log_verbosity_gcry_log_verbosity_gcry_log_gcry_bug_gcry_assert_failed_gcry_log_info_gcry_log_info_with_dummy_fp_gcry_log_error_gcry_log_fatal_gcry_log_bug_gcry_log_debug_gcry_log_printf_gcry_log_printhex_gcry_burn_stack_gcry_global_is_operational_gcry_check_version_gcry_vcontrol_gcry_control_gcry_strerror_gcry_strsource_gcry_err_code_from_errno_gcry_err_code_to_errno_gcry_err_make_from_errno_gcry_error_from_errno_gcry_set_allocation_handler_gcry_set_outofcore_handler_gcry_malloc_gcry_malloc_secure_gcry_is_secure_gcry_check_heap_gcry_realloc_gcry_free_gcry_calloc_gcry_calloc_secure_gcry_strdup_gcry_xmalloc_gcry_xrealloc_gcry_xmalloc_secure_gcry_xcalloc_gcry_xcalloc_secure_gcry_xstrdup_gcry_get_debug_flag_gcry_set_progress_handler_gcry_sexp_dump_gcry_sexp_release_gcry_sexp_create_gcry_sexp_canon_len_gcry_sexp_new_gcry_sexp_cons_gcry_sexp_alist_gcry_sexp_vlist_gcry_sexp_append_gcry_sexp_prepend_gcry_sexp_find_token_gcry_sexp_length_gcry_sexp_nth_gcry_sexp_car_gcry_sexp_nth_data_gcry_sexp_nth_string_gcry_sexp_nth_mpi_gcry_sexp_cdr_gcry_sexp_cadr_gcry_sexp_build_gcry_sexp_vbuild_gcry_sexp_build_array_gcry_sexp_sscan_gcry_sexp_sprint_gcry_get_hw_features_gcry_detect_hw_features_gcry_private_enable_m_guard_gcry_private_malloc_gcry_private_malloc_secure_gcry_private_realloc_gcry_private_check_heap_gcry_private_free_gcry_secmem_set_flags_gcry_secmem_get_flags_gcry_secmem_init_gcry_secmem_malloc_gcry_secmem_free_gcry_secmem_realloc_gcry_private_is_secure_gcry_secmem_term_gcry_secmem_dump_stats_gcry_module_add_gcry_module_lookup_id_gcry_module_lookup_gcry_module_release_gcry_module_use_gcry_module_list_gcry_initialize_fips_mode_gcry_fips_mode_gcry_fips_noreturn_gcry_enforced_fips_mode_gcry_inactivate_fips_mode_gcry_fips_signal_error_gcry_is_fips_mode_inactive_gcry_fips_is_operational_gcry_fips_run_selftests_gcry_fips_test_operational_gcry_fips_test_error_or_operational_gcry_hmac256_update_gcry_hmac256_new_gcry_hmac256_release_gcry_hmac256_finalize_gcry_hmac256_file_gcry_ath_init_gcry_ath_install_gcry_ath_mutex_init_gcry_ath_mutex_destroy_gcry_ath_mutex_lock_gcry_ath_mutex_unlock_gcry_ath_read_gcry_ath_write_gcry_ath_select_gcry_ath_waitpid_gcry_ath_accept_gcry_ath_connect_gcry_ath_sendmsg_gcry_ath_recvmsg__i686.get_pc_thunk.bx_gcry_cipher_register_gcry_cipher_unregister_gcry_cipher_map_name_gcry_cipher_mode_from_oid_gcry_cipher_algo_name_gcry_cipher_open_gcry_cipher_close_gcry_cipher_encrypt_gcry_cipher_decrypt_gcry_cipher_setkey_gcry_cipher_setiv_gcry_cipher_setctr_gcry_cipher_ctl_gcry_cipher_info_gcry_cipher_algo_info_gcry_cipher_get_algo_keylen_gcry_cipher_get_algo_blklen_gcry_cipher_init_gcry_cipher_list_gcry_cipher_selftest__i686.get_pc_thunk.bx_gcry_digest_spec_md5__i686.get_pc_thunk.bxprimepool_gcry_register_primegen_progress__i686.get_pc_thunk.cx_gcry_generate_secret_prime_gcry_generate_public_prime_gcry_generate_elg_prime_gcry_prime_generate_gcry_prime_check_gcry_prime_group_generator_gcry_prime_release_factors_gcry_derive_x931_prime_gcry_generate_fips186_2_prime_gcry_generate_fips186_3_prime__i686.get_pc_thunk.bx_gcry_cipher_spec_twofish_gcry_cipher_spec_twofish128__i686.get_pc_thunk.cx_gcry_digest_spec_crc32_gcry_digest_spec_crc32_rfc1510_gcry_digest_spec_crc24_rfc2440__i686.get_pc_thunk.bx_gcry_md_register_gcry_md_unregister_gcry_md_map_name_gcry_md_algo_name_gcry_md_open_gcry_md_enable_gcry_md_copy_gcry_md_reset_gcry_md_close_gcry_md_write_gcry_md_hash_buffer_gcry_md_ctl_gcry_md_setkey_gcry_md_debug_gcry_md_read_gcry_md_get_gcry_md_get_algo_gcry_md_get_algo_dlen_gcry_md_algo_info_gcry_md_info_gcry_md_init_gcry_md_is_secure_gcry_md_is_enabled_gcry_md_list_gcry_md_selftest__i686.get_pc_thunk.bx_gcry_cipher_spec_cast5__i686.get_pc_thunk.bx_gcry_hmac_selftest_gcry_register_pk_dsa_progress__i686.get_pc_thunk.cx__i686.get_pc_thunk.bx_gcry_pubkey_spec_dsa_gcry_pubkey_extraspec_dsa__i686.get_pc_thunk.bx_gcry_digest_spec_tiger_gcry_rmd160_init__i686.get_pc_thunk.bx_gcry_rmd160_mixblock_gcry_rmd160_hash_buffer_gcry_digest_spec_rmd160__i686.get_pc_thunk.bx_gcry_pubkey_spec_rsa_gcry_pubkey_extraspec_rsa_gcry_camellia_setup128__i686.get_pc_thunk.bx_gcry_camellia_setup256_gcry_camellia_setup192_gcry_camellia_encrypt128_gcry_camellia_decrypt128_gcry_camellia_encrypt256_gcry_camellia_decrypt256_gcry_Camellia_Ekeygen_gcry_Camellia_EncryptBlock_gcry_Camellia_DecryptBlock__i686.get_pc_thunk.bx_gcry_digest_spec_sha224_gcry_digest_extraspec_sha224_gcry_digest_spec_sha256_gcry_digest_extraspec_sha256__i686.get_pc_thunk.bx_gcry_digest_spec_sha512_gcry_digest_extraspec_sha512_gcry_digest_spec_sha384_gcry_digest_extraspec_sha384__i686.get_pc_thunk.bx_gcry_sha1_hash_buffer_gcry_digest_spec_sha1_gcry_digest_extraspec_sha1_gcry_hash_selftest_check_one__i686.get_pc_thunk.bx__i686.get_pc_thunk.bx__i686.get_pc_thunk.cx_gcry_cipher_spec_seed__i686.get_pc_thunk.bx_gcry_cipher_spec_blowfish__i686.get_pc_thunk.bx__i686.get_pc_thunk.cx_gcry_cipher_spec_des_gcry_cipher_spec_tripledes_gcry_cipher_extraspec_tripledes_gcry_register_pk_ecc_progress__i686.get_pc_thunk.cx__i686.get_pc_thunk.bx_gcry_pubkey_spec_ecdsa_gcry_pubkey_extraspec_ecdsa_gcry_register_pk_elg_progress__i686.get_pc_thunk.cx__i686.get_pc_thunk.bx_gcry_pubkey_spec_elg_gcry_pubkey_extraspec_elg__i686.get_pc_thunk.bx_gcry_pk_register_gcry_pk_unregister_gcry_pk_map_name_gcry_pk_algo_name_gcry_pk_aliased_algo_name_gcry_pk_encrypt_gcry_pk_get_nbits_gcry_pk_decrypt_gcry_pk_sign_gcry_pk_verify_gcry_pk_testkey_gcry_pk_genkey_gcry_pk_get_keygrip_gcry_pk_ctl_gcry_pk_algo_info_gcry_pk_init_gcry_pk_module_lookup_gcry_pk_module_release_gcry_pk_list_gcry_pk_selftest_gcry_pk_get_elements__i686.get_pc_thunk.bx_gcry_digest_spec_md4__i686.get_pc_thunk.bx_gcry_digest_spec_whirlpool__i686.get_pc_thunk.bx_gcry_cipher_spec_rfc2268_40__i686.get_pc_thunk.bx_gcry_cipher_spec_arcfour__i686.get_pc_thunk.bx_gcry_aes_cfb_enc_gcry_aes_cbc_enc_gcry_aes_cfb_dec_gcry_aes_cbc_dec_gcry_cipher_spec_aes_gcry_cipher_extraspec_aes_gcry_cipher_spec_aes192_gcry_cipher_extraspec_aes192_gcry_cipher_spec_aes256_gcry_cipher_extraspec_aes256ac_key_generate_specs_gcry_ac_data_new__i686.get_pc_thunk.bx_gcry_ac_data_destroy_gcry_ac_data_copy_gcry_ac_data_length_gcry_ac_data_set_gcry_ac_data_get_name_gcry_ac_data_get_index_gcry_ac_data_to_sexp_gcry_ac_data_from_sexpgcry_ac_data_dump_gcry_ac_data_clear_gcry_ac_io_init_va_gcry_ac_io_init_gcry_ac_open_gcry_ac_close_gcry_ac_key_init_gcry_ac_key_pair_generate_gcry_ac_key_pair_extract_gcry_ac_key_destroy_gcry_ac_key_pair_destroy_gcry_ac_key_data_get_gcry_ac_key_test_gcry_ac_key_get_nbits_gcry_ac_key_get_grip_gcry_ac_data_encrypt_gcry_ac_data_decrypt_gcry_ac_data_sign_gcry_ac_data_verify_gcry_ac_data_encode_gcry_ac_data_decode_gcry_ac_mpi_to_os_gcry_ac_mpi_to_os_alloc_gcry_ac_os_to_mpi__i686.get_pc_thunk.cx_gcry_ac_data_encrypt_scheme_gcry_ac_data_decrypt_scheme_gcry_ac_data_sign_scheme_gcry_ac_data_verify_scheme_gcry_ac_init__i686.get_pc_thunk.bx_gcry_cipher_spec_serpent128_gcry_cipher_spec_serpent192_gcry_cipher_spec_serpent256__i686.get_pc_thunk.bx_gcry_cipher_spec_camellia128_gcry_cipher_spec_camellia192_gcry_cipher_spec_camellia256__i686.get_pc_thunk.bx_gcry_rndlinux_gather_random__i686.get_pc_thunk.bx_gcry_rngcsprng_initialize_gcry_rngcsprng_dump_stats_gcry_rngcsprng_secure_alloc__i686.get_pc_thunk.cx_gcry_rngcsprng_enable_quick_gen_gcry_rngcsprng_set_daemon_socket_gcry_rngcsprng_use_daemon_gcry_rngcsprng_is_faked_gcry_rngcsprng_add_bytes_gcry_rngcsprng_randomize_gcry_rngcsprng_set_seed_file_gcry_rngcsprng_update_seed_file_gcry_rngcsprng_fast_poll_gcry_rngcsprng_create_nonce_gcry_register_random_progress__i686.get_pc_thunk.cx_gcry_random_progress__i686.get_pc_thunk.bx_gcry_random_initialize_gcry_random_dump_stats_gcry_secure_random_alloc_gcry_enable_quick_random_gen_gcry_set_random_daemon_socket_gcry_use_random_daemon_gcry_random_is_faked_gcry_random_add_bytes_gcry_random_bytes_gcry_random_bytes_secure_gcry_randomize_gcry_set_random_seed_file_gcry_update_random_seed_file_gcry_fast_random_poll_gcry_create_nonce_gcry_random_selftest_gcry_random_init_external_test_gcry_random_run_external_test_gcry_random_deinit_external_test__i686.get_pc_thunk.bx_gcry_rngfips_initialize_gcry_rngfips_dump_stats_gcry_rngfips_is_faked_gcry_rngfips_add_bytes_gcry_rngfips_randomize_gcry_rngfips_create_nonce_gcry_rngfips_selftest_gcry_rngfips_init_external_test_gcry_rngfips_run_external_test_gcry_rngfips_deinit_external_test__i686.get_pc_thunk.bx_gcry_rndhw_failed_p__i686.get_pc_thunk.cx_gcry_rndhw_poll_fast_gcry_rndhw_poll_slow_gcry_mpih_lshift_gcry_mpi_get_hw_config__i686.get_pc_thunk.cx_gcry_mpi_alloc__i686.get_pc_thunk.bx_gcry_mpi_alloc_limb_space_gcry_mpi_m_check_gcry_mpi_alloc_secure_gcry_mpi_free_limb_space_gcry_mpi_assign_limb_space_gcry_mpi_resize_gcry_mpi_clear_gcry_mpi_free_gcry_mpi_set_opaque_gcry_mpi_get_opaque_gcry_mpi_copy_gcry_mpi_alloc_like_gcry_mpi_set_gcry_mpi_set_ui_gcry_mpi_get_uigcry_mpi_get_ui_gcry_mpi_alloc_set_ui_gcry_mpi_swap_gcry_mpi_new_gcry_mpi_snew_gcry_mpi_release_gcry_mpi_randomize_gcry_mpi_set_flag_gcry_mpi_clear_flag_gcry_mpi_get_flag_gcry_mpih_sub_n_gcry_mpi_fdiv_r__i686.get_pc_thunk.bx_gcry_mpi_tdiv_r_gcry_mpi_fdiv_r_ui_gcry_mpi_fdiv_q_gcry_mpi_fdiv_qr_gcry_mpi_tdiv_qr_gcry_mpi_tdiv_q_2exp_gcry_mpi_divisible_ui_gcry_mpi_div_gcry_mpi_ec_point_init__i686.get_pc_thunk.bx_gcry_mpi_ec_point_free_gcry_mpi_ec_init_gcry_mpi_ec_free_gcry_mpi_ec_get_affine_gcry_mpi_ec_dup_point_gcry_mpi_ec_add_points_gcry_mpi_ec_mul_point_gcry_mpi_invm__i686.get_pc_thunk.bx_gcry_mpih_add_1_gcry_mpih_add__i686.get_pc_thunk.bx_gcry_mpih_sub_1_gcry_mpih_sub_gcry_mpih_cmp_gcry_mpi_mod__i686.get_pc_thunk.bx_gcry_mpi_barrett_init_gcry_mpi_barrett_free_gcry_mpi_mod_barrett_gcry_mpi_mul_barrett_gcry_mpih_add_n_gcry_mpi_cmp_ui__i686.get_pc_thunk.bx_gcry_mpi_cmp_gcry_mpih_addmul_1__i686.get_pc_thunk.bx_gcry_mpi_dump_gcry_log_mpidump_gcry_mpi_get_buffer_gcry_mpi_get_secure_buffer_gcry_mpi_set_buffer_gcry_mpi_scan_gcry_mpi_print_gcry_mpi_aprint_gcry_mpi_normalize_gcry_mpi_get_nbits_gcry_mpi_test_bit_gcry_mpi_set_bit__i686.get_pc_thunk.bx_gcry_mpi_set_highbit_gcry_mpi_clear_highbit_gcry_mpi_clear_bit_gcry_mpi_rshift_limbs_gcry_mpi_rshift_gcry_mpi_lshift_limbs_gcry_mpi_lshift_gcry_mpi_gcd__i686.get_pc_thunk.bx_gcry_mpih_rshift_gcry_mpi_getbyte_gcry_mpi_putbyte__i686.get_pc_thunk.bx_gcry_mpi_trailing_zeros__i686.get_pc_thunk.bx_gcry_mpih_sqr_n_basecase_gcry_mpih_sqr_n_gcry_mpih_mul_n_gcry_mpih_mul_karatsuba_case_gcry_mpih_mul_gcry_mpih_release_karatsuba_ctx_gcry_mpih_mul_1_gcry_mpih_mod_1_gcry_mpih_divrem__i686.get_pc_thunk.bx_gcry_mpih_divmod_1__i686.get_pc_thunk.bx_gcry_mpi_mulpowm_gcry_mpi_add_ui__i686.get_pc_thunk.bx_gcry_mpi_add_gcry_mpi_sub_ui_gcry_mpi_sub_gcry_mpi_addm_gcry_mpi_subm_gcry_mpi_powm__i686.get_pc_thunk.bx_gcry_mpih_submul_1_gcry_mpi_mul_ui__i686.get_pc_thunk.bx_gcry_mpi_mul_2exp_gcry_mpi_mul_gcry_mpi_mulm// 322 ` libgcrypt_la-visibility.o/ libgcrypt_la-misc.o/ libgcrypt_la-global.o/ libgcrypt_la-sexp.o/ libgcrypt_la-hwfeatures.o/ libgcrypt_la-stdmem.o/ libgcrypt_la-secmem.o/ libgcrypt_la-missing-string.o/ libgcrypt_la-module.o/ libgcrypt_la-fips.o/ libgcrypt_la-hmac256.o/ libgcrypt_la-ath.o/ mpih-lshift-asm.o/ mpih-rshift-asm.o/ /0 1249659000 0 1000 100644 23808 ` ELF4( UE$UE$UE$UE$UE D$E$UE$UE$UE EED$E$EEUED$ ED$E D$E$UED$ED$ ED$E D$E$UED$ ED$E D$E$U(EEED$ ED$E D$E$EEUED$ ED$E D$E$UE$UED$ ED$E D$E$UED$ ED$E D$E$UE$UE D$E$UE$UD$D$$UE D$E$UE D$E$UED$E D$E$UE$UE D$E$UE$UE$UE$UED$E D$E$UE D$E$UED$E D$E$UE$UE$UE$UE$UE D$E$UE D$E$UE D$E$UE D$E$UE D$E$UED$ED$ ED$E D$E$UED$ED$ ED$E D$E$UED$ ED$E D$E$UE$UED$E D$E$UED$E D$E$UED$ ED$E D$E$UED$E D$E$UED$E D$E$UED$ ED$E D$E$UED$E D$E$UED$E D$E$UED$ ED$E D$E$UED$E D$E$UED$ED$ ED$E D$E$UED$E D$E$UED$ ED$E D$E$UED$E D$E$UED$E D$E$UE$UE D$E$UE D$E$UE D$E$UE D$E$UE D$E$UED$E D$E$UED$E D$E$UED$E D$E$UE D$E$UE D$E$UE D$E$UE D$E$UuE$-E#ED$ ED$E D$E$EEUED$$U} tEE MEEUE$Uu$EED$E D$E$EEUu$HEED$E D$E$EEUu$EED$E D$E$EEUu$E#ED$ ED$E D$E$EEUED$ ED$E D$E$Uu$VE#ED$ ED$E D$E$EEUE$UE$UE$Uu1} tED$D$BE $$E*ED$ED$ ED$E D$E$EEUu$fE*ED$ED$ ED$E D$E$EEUE$UE$UE D$E$UuE$EED$E D$E$EEUuE$EED$E D$E$EEUuE$:EED$E D$E$EEUu$EED$E D$E$EEUu$EE$EEUuE$|EE D$E$EEUED$E D$E$Uu$!E#ED$ ED$E D$E$EEUE$UE$Uu EE$EEUu EE D$E$EEUE D$E$UuE$3EED$E D$E$EEUE$Uu$EE D$E$EEUuE$EE D$E$EEUE$Uu$OE#ED$ ED$E D$E$EEUtED$E D$E$UE D$E$Uu,D$4D$ D$D$5$ED$ ED$E D$E$Uu5D$eD$ D$TD$@$EE$EEUE$Uu EE D$E$EEUE$Uu$E#ED$ ED$E D$E$EEUED$ ED$E D$E$UE$UE$Uu$!EED$E D$E$EEUE D$E$UE D$E$UE$UE$UE D$E$UE$UE$UED$ ED$E D$E$UED$ ED$E D$E$UED$ED$ ED$E D$E$UED$E D$E$UED$E D$E$U(EEED$ ED$E D$E$UED$ ED$E D$E$UED$E D$E$UE$UED$ ED$E D$E$UED$ED$ ED$E D$E$UE D$E$UE$UE D$E$UED$E D$E$UED$E D$E$UE$UE$UED$ED$ ED$E D$E$UED$ED$ ED$E D$E$UED$ED$ ED$E D$E$UED$ED$ ED$E D$E$UED$ ED$E D$E$UED$ ED$E D$E$U(E D$ED$ED$ED$ ED$E D$E$U(E D$ED$ED$ED$ ED$E D$E$U(E D$ED$ED$ED$ ED$E D$E$U(E D$ED$ED$ED$ ED$E D$E$UE$EEu$EU EEEUED$$ UE D$E$UE$E}u$EUE EEUu1D$4D$ D$D$$ED$E D$E$Uu$EED$E D$E$EEUu1D$4D$ D$D$$E D$E$Uu1D$4D$ D$D$$E D$E$UED$E D$E$Uu1D$4D$ D$D$$E D$E$U(E$D$E D$ED$ED$ED$ ED$E D$E$UED$ ED$E D$E$UE$UE D$E$UE D$E$UED$ED$ ED$E D$E$UE D$E$UE D$E$UE D$E$UE$UE$UE D$E$UE$UE D$E$UE D$E$UE$UE$UE D$E$UE$UE D$E$UE D$E$UE$UE$UE$UED$ E D$D$E$UE$UED$ E D$D$E$UE$UED$ E D$D$E$UE$gcry_sexp_vlistvisibility.cgcry_md_hash_buffercalled in non-operational stategcry_md_get_algoused in non-operational stategcry_randomizegcry_random_bytesgcry_random_bytes_securegcry_create_nonceGCC: (GNU) 4.2.2.symtab.strtab.shstrtab.rel.text.data.bss.rodata.comment.note.GNU-stack4% U %\+\0\8+A==QH@  8} *.7IT[ft&+9BZLsfy&( /+= (M^14ne((( -=L\l}0"Rl! -;JXgu !.H!i'5|CRcu'7/5Df/Sc(s!!(:![!%6|(DS!`n!~(!//^!($!1?!M\o0J  d4 L ~!\ m !}  !       . /@ S IQd     A  7 A  x A * H: K  (\ n ) H  q      ( o< C X  Ol  h   {     J& 7 JG X < Je s A  3  C  = !  ^ H  "5 FX +j} 2)CJ:C%3AP0H\ix*w]Wp22EYk~H(8K^A%3BO]n&  9(1Ca(Yp/!!. ((0P!=KqYh(y//A"!WnC!dw/ /2G/\r/F(n(=$=@]=vM=C?A[ A6MT_r1T!TD>(5Qfly/4Pl*=P j,@}Sgt#1@8M[Kep^q)) 3)DVivisibility.c__FUNCTION__.5795gpg_errorgpg_err_make__FUNCTION__.6465__FUNCTION__.6472gcry_errorgcry_err_make__FUNCTION__.6845__FUNCTION__.6865__FUNCTION__.6876__FUNCTION__.6892gcry_strerror_gcry_strerrorgcry_strsource_gcry_strsourcegcry_err_code_from_errno_gcry_err_code_from_errnogcry_err_code_to_errno_gcry_err_code_to_errnogcry_err_make_from_errno_gcry_err_make_from_errnogcry_error_from_errno_gcry_error_from_errnogcry_check_version_gcry_check_versiongcry_control_gcry_vcontrolgcry_sexp_new_gcry_sexp_newgcry_sexp_create_gcry_sexp_creategcry_sexp_sscan_gcry_sexp_sscangcry_sexp_build_gcry_sexp_vbuildgcry_sexp_build_array_gcry_sexp_build_arraygcry_sexp_release_gcry_sexp_releasegcry_sexp_canon_len_gcry_sexp_canon_lengcry_sexp_sprint_gcry_sexp_sprintgcry_sexp_dump_gcry_sexp_dumpgcry_sexp_cons_gcry_sexp_consgcry_sexp_alist_gcry_sexp_alistgcry_sexp_vlist_gcry_buggcry_sexp_append_gcry_sexp_appendgcry_sexp_prepend_gcry_sexp_prependgcry_sexp_find_token_gcry_sexp_find_tokengcry_sexp_length_gcry_sexp_lengthgcry_sexp_nth_gcry_sexp_nthgcry_sexp_car_gcry_sexp_cargcry_sexp_cdr_gcry_sexp_cdrgcry_sexp_cadr_gcry_sexp_cadrgcry_sexp_nth_data_gcry_sexp_nth_datagcry_sexp_nth_string_gcry_sexp_nth_stringgcry_sexp_nth_mpi_gcry_sexp_nth_mpigcry_mpi_new_gcry_mpi_newgcry_mpi_snew_gcry_mpi_snewgcry_mpi_release_gcry_mpi_releasegcry_mpi_copy_gcry_mpi_copygcry_mpi_set_gcry_mpi_setgcry_mpi_set_ui_gcry_mpi_set_uigcry_mpi_swap_gcry_mpi_swapgcry_mpi_cmp_gcry_mpi_cmpgcry_mpi_cmp_ui_gcry_mpi_cmp_uigcry_mpi_scan_gcry_mpi_scangcry_mpi_print_gcry_mpi_printgcry_mpi_aprint_gcry_mpi_aprintgcry_mpi_dump_gcry_mpi_dumpgcry_mpi_add_gcry_mpi_addgcry_mpi_add_ui_gcry_mpi_add_uigcry_mpi_addm_gcry_mpi_addmgcry_mpi_sub_gcry_mpi_subgcry_mpi_sub_ui_gcry_mpi_sub_uigcry_mpi_subm_gcry_mpi_submgcry_mpi_mul_gcry_mpi_mulgcry_mpi_mul_ui_gcry_mpi_mul_uigcry_mpi_mulm_gcry_mpi_mulmgcry_mpi_mul_2exp_gcry_mpi_mul_2expgcry_mpi_div_gcry_mpi_divgcry_mpi_mod_gcry_mpi_modgcry_mpi_powm_gcry_mpi_powmgcry_mpi_gcd_gcry_mpi_gcdgcry_mpi_invm_gcry_mpi_invmgcry_mpi_get_nbits_gcry_mpi_get_nbitsgcry_mpi_test_bit_gcry_mpi_test_bitgcry_mpi_set_bit_gcry_mpi_set_bitgcry_mpi_clear_bit_gcry_mpi_clear_bitgcry_mpi_set_highbit_gcry_mpi_set_highbitgcry_mpi_clear_highbit_gcry_mpi_clear_highbitgcry_mpi_rshift_gcry_mpi_rshiftgcry_mpi_lshift_gcry_mpi_lshiftgcry_mpi_set_opaque_gcry_mpi_set_opaquegcry_mpi_get_opaque_gcry_mpi_get_opaquegcry_mpi_set_flag_gcry_mpi_set_flaggcry_mpi_clear_flag_gcry_mpi_clear_flaggcry_mpi_get_flag_gcry_mpi_get_flaggcry_cipher_open_gcry_global_is_operational_gcry_cipher_opengcry_cipher_close_gcry_cipher_closegcry_cipher_setkey_gcry_cipher_setkeygcry_cipher_setiv_gcry_cipher_setivgcry_cipher_setctr_gcry_cipher_setctrgcry_cipher_ctl_gcry_cipher_ctlgcry_cipher_info_gcry_cipher_infogcry_cipher_algo_info_gcry_cipher_algo_infogcry_cipher_algo_name_gcry_cipher_algo_namegcry_cipher_map_name_gcry_cipher_map_namegcry_cipher_mode_from_oid_gcry_cipher_mode_from_oidgcry_cipher_encryptmemset_gcry_cipher_encryptgcry_cipher_decrypt_gcry_cipher_decryptgcry_cipher_get_algo_keylen_gcry_cipher_get_algo_keylengcry_cipher_get_algo_blklen_gcry_cipher_get_algo_blklengcry_cipher_list_gcry_cipher_listgcry_pk_encrypt_gcry_pk_encryptgcry_pk_decrypt_gcry_pk_decryptgcry_pk_sign_gcry_pk_signgcry_pk_verify_gcry_pk_verifygcry_pk_testkey_gcry_pk_testkeygcry_pk_genkey_gcry_pk_genkeygcry_pk_ctl_gcry_pk_ctlgcry_pk_algo_info_gcry_pk_algo_infogcry_pk_algo_name_gcry_pk_algo_namegcry_pk_map_name_gcry_pk_map_namegcry_pk_get_nbits_gcry_pk_get_nbitsgcry_pk_get_keygrip_gcry_pk_get_keygripgcry_pk_list_gcry_pk_listgcry_md_open_gcry_md_opengcry_md_close_gcry_md_closegcry_md_enable_gcry_md_enablegcry_md_copy_gcry_md_copygcry_md_reset_gcry_md_resetgcry_md_ctl_gcry_md_ctlgcry_md_write_gcry_md_writegcry_md_read_gcry_md_readgcry_md_hash_buffer_gcry_fips_signal_error_gcry_md_hash_buffergcry_md_get_algo_gcry_md_get_algogcry_md_get_algo_dlen_gcry_md_get_algo_dlengcry_md_is_enabled_gcry_md_is_enabledgcry_md_is_secure_gcry_md_is_securegcry_md_info_gcry_md_infogcry_md_algo_info_gcry_md_algo_infogcry_md_algo_name_gcry_md_algo_namegcry_md_map_name_gcry_md_map_namegcry_md_setkey_gcry_md_setkeygcry_md_debug_gcry_md_debuggcry_md_list_gcry_md_listgcry_ac_data_new_gcry_ac_data_newgcry_ac_data_destroy_gcry_ac_data_destroygcry_ac_data_copy_gcry_ac_data_copygcry_ac_data_length_gcry_ac_data_lengthgcry_ac_data_clear_gcry_ac_data_cleargcry_ac_data_set_gcry_ac_data_setgcry_ac_data_get_name_gcry_ac_data_get_namegcry_ac_data_get_index_gcry_ac_data_get_indexgcry_ac_data_to_sexp_gcry_ac_data_to_sexpgcry_ac_data_from_sexp_gcry_ac_data_from_sexpgcry_ac_io_init_gcry_ac_io_init_vagcry_ac_io_init_vagcry_ac_open_gcry_ac_opengcry_ac_close_gcry_ac_closegcry_ac_key_init_gcry_ac_key_initgcry_ac_key_pair_generate_gcry_ac_key_pair_generategcry_ac_key_pair_extract_gcry_ac_key_pair_extractgcry_ac_key_data_get_gcry_ac_key_data_getgcry_ac_key_test_gcry_ac_key_testgcry_ac_key_get_nbits_gcry_ac_key_get_nbitsgcry_ac_key_get_grip_gcry_ac_key_get_gripgcry_ac_key_destroy_gcry_ac_key_destroygcry_ac_key_pair_destroy_gcry_ac_key_pair_destroygcry_ac_data_encode_gcry_ac_data_encodegcry_ac_data_decode_gcry_ac_data_decodegcry_ac_data_encrypt_gcry_ac_data_encryptgcry_ac_data_decrypt_gcry_ac_data_decryptgcry_ac_data_sign_gcry_ac_data_signgcry_ac_data_verify_gcry_ac_data_verifygcry_ac_data_encrypt_scheme_gcry_ac_data_encrypt_schemegcry_ac_data_decrypt_scheme_gcry_ac_data_decrypt_schemegcry_ac_data_sign_scheme_gcry_ac_data_sign_schemegcry_ac_data_verify_scheme_gcry_ac_data_verify_schemegcry_ac_id_to_namegcry_ac_name_to_idgcry_randomize_gcry_fips_noreturn_gcry_randomizegcry_random_add_bytes_gcry_random_add_bytesgcry_random_bytes_gcry_random_bytesgcry_random_bytes_secure_gcry_random_bytes_securegcry_mpi_randomize_gcry_mpi_randomizegcry_create_nonce_gcry_create_noncegcry_prime_generate_gcry_prime_generategcry_prime_group_generator_gcry_prime_group_generatorgcry_prime_release_factors_gcry_prime_release_factorsgcry_prime_check_gcry_prime_checkgcry_set_progress_handler_gcry_set_progress_handlergcry_set_allocation_handler_gcry_set_allocation_handlergcry_set_outofcore_handler_gcry_set_outofcore_handlergcry_set_fatalerror_handler_gcry_set_fatalerror_handlergcry_set_log_handler_gcry_set_log_handlergcry_set_gettext_handler_gcry_set_gettext_handlergcry_malloc_gcry_mallocgcry_calloc_gcry_callocgcry_malloc_secure_gcry_malloc_securegcry_calloc_secure_gcry_calloc_securegcry_realloc_gcry_reallocgcry_strdup_gcry_strdupgcry_xmalloc_gcry_xmallocgcry_xcalloc_gcry_xcallocgcry_xmalloc_secure_gcry_xmalloc_securegcry_xcalloc_secure_gcry_xcalloc_securegcry_xrealloc_gcry_xreallocgcry_xstrdup_gcry_xstrdupgcry_free_gcry_freegcry_is_secure_gcry_is_securegcry_cipher_register_gcry_cipher_registergcry_cipher_unregister_gcry_cipher_unregistergcry_pk_register_gcry_pk_registergcry_pk_unregister_gcry_pk_unregistergcry_md_register_gcry_md_registergcry_md_unregister_gcry_md_unregister  3F`s "$&+(Y*,.0246*8:IN:f<>@BDFHJ(LBNcPvRTVXZ\^`1b`dfhjl n4pUrvtvxz|)~Xy*D^x)CP+ > l     # 0 e ~       \ u      0 C z      1 X e       =J*7l ,<KPd}2EXe     3["Jk ~"$&(*,=.^0q2468:@<h>@B DGFHHTdsx}LMOL+Q8DTchmLSULW8Y`[s]_ace g$i7kJmdowqsuwy{}2EXk /27 1249659000 0 1000 100644 4112 ` ELF4( UE]UtU$ЉEEEEUE E]UE$D$ED$$U} uE$E t(u E D$ED$$ыE D$D$ D$D$R$$TE $I$(=UE E ]UE]U;E]U t+ ED$ E D$ED$ $EE}}#} }}}2t5}dtV}(tuD$ D$D$$5kD$ D$ D$$=DD$ D$D$$KED$D$Q$UT$U T$$}(t}2u6D$jD$ D$*D$$U(EEED$E D$E$cUED$E D$ ED$D$$2UED$ED$E D$ ED$D$$2U(E EED$ED$$ U(EEED$E D$$ U(E EED$ED$$wU(E EED$ED$$(OU(E EED$ED$$2$U(E EED$ED$$dU(}t E EED$ED$$U}tEtED$$}tPE EED$$mEED$$Em}uك}t $(UTEEE@EEm}uE@E}~ E$_gcry_fatal_errormisc.c Fatal error: _gcry_logvFatal: Ohhhh jeeee: DBG: [Unknown log level %d]: internal error (fatal or bug)... this is a bug (%s:%d:%s) Assertion `%s' failed (%s:%d:%s) %s %02X %02XGCC: (GNU) 4.2.2.symtab.strtab.shstrtab.rel.text.data.bss.rodata.comment.note.GNU-stack4_  %+08mAQ   ,F RdyN** Px  ,9x&6N`f|0 ='4#;^(-(++;+I1(YY.j}Emisc.cverbosity_levelfatal_error_handlerfatal_error_handler_valuelog_handlerlog_handler_valueuser_gettext_handlerwrite2stderr__FUNCTION__.6081__FUNCTION__.6125_gcry_logv_gcry_set_gettext_handler_gcry_gettext_gcry_set_fatalerror_handlerstrlenwrite_gcry_fatal_errorgpg_strerror_gcry_fips_mode_gcry_fips_signal_error_gcry_secmem_termabort_gcry_set_log_handler_gcry_set_log_verbosity_gcry_log_verbositystderrfwritefprintfvfprintf_gcry_log_gcry_bug_gcry_assert_failed_gcry_log_info_gcry_log_info_with_dummy_fp_gcry_log_error_gcry_log_fatal_gcry_log_bug_gcry_log_debug_gcry_log_printf_gcry_log_printhex_gcry_burn_stack@H[r    "*7AWag  !  !& A F!N ] e"j #    $I U$Z- , - - -Y//48 1249659001 0 1000 100644 12640 ` ELF4( U(E ur E}u>$E}uE}uE}uD$D$y$ U uD$$ NUEE<0uSE%t,EjUEE0EEE%uU E}xEEEEEEUE D$E$2E}t E<.t E`EED$E$E}t E<.t E.EED$E$E}u EEEEUHE_}u EEED$ ED$ED$E$$E}u EE܉D$ ED$ED$E$E}u EUE9fUE9u UE9RUE9uUE9u UE94UE9u2UE9u(UE9uED$E$xEEEEUWVP}оD$_D$E $ED$D$E $ED$"D$6E $ED$DD$zE $ED$E $ED$D$E $EED$E $EE0ED#EtEDԉD$D$E $EЃEEDԅuD$E $Et EyEnt EyEnED$ EĉD$D$E $EЃP^_]UhEE E}/UE$,U BE Ћ$\EPA$,$$IU BE Ћ$U BE Ћ$U BE Ћ УU BE Ћҡ!Уh^ QEE8E,f$ U BE ЋL$$Eȃ}$$<EU BE Ћ$s$U BE Ћ$EU BE ЋẼ}t EEẺD$E$oE,E ut $Ev$E]U BE ЋEЋU BE ЋEԋU BE ЋE؋U BE ЋE܋U BE ЋEU BE ЋEU BE ЋEU BE ЋEu EȰED$ED$ED$ED$E܉D$ E؉D$EԉD$EЉ$EU BE ЋEU BE ЋEU BE ЋEu EȰBUED$T$E$E$U BE ЋEE$E=Eȉ$KUED$$U} tEE MEEUED$$ UE D$E$UE EED$E$EEUE$UE$UE$UE$UE D$E$UE $D$E$UE$$Ut $EE EEE Ut$E$E (U,u E$t,E,EEUEE 4u4u+tU$ЉE9E$E)tU$ЉEE$E}u*u $EUEEU(EED$D$E$&EU(EED$D$E$EUt E)tU$ЉEE$EEU]UtE D$E$҉EE D$E$E}uu EU}t@E t E$ E$}t ‹EU(EE E} t$Eu ;Et E4E$E}tED$D$E$EEEU(EE E} t$Eu ;Et E4E$E}tED$D$E$EEEUEEE$EE$tE$EE$E}tED$E$EU(Uu-$t$ $(D$ED$$хu$D$$E$E}tEU(uuM$tD$EE$t EE(UT$U T$$Uu$D$$E D$E$E}lEUS$_u-$t$ $(D$ED$$хu)$$\$$E$E}tE$[]U(EE E} t:Eu ;Et* $D$$E$EED$D$E$EU(EE E} t:Eu ;Et* $D$$E$EED$D$E$EU(E$EE$Eu,$t# $E(D$ED$$хu<}t$EE$UT$$E$E}SEUt E #EEEUE D$E$E D$E$E D$E$E D$E$global_initglobal.cLibgcrypt warning: missing initialization - please fix the application1.4.4padlock-rngpadlock-aespadlock-shaeq}version:%s: arcfour:blowfish:cast5:des:aes:twofish:serpent:rfc2268:seed:camelliaciphers:%s: dsa:elgamal:rsa:eccpubkeys:%s: crc:md4:md5:rmd160:sha1:sha256:sha512:tiger:whirlpooldigests:%s: rnd-mod:linux: mpi-asm:%s: hwflist:%s: fips-mode:%c:%c:   * .d s LoV 'Ao>W0 custom allocation handlerout of core handler ignored in FIPS mode out of core in secure memoryGCC: (GNU) 4.2.2.symtab.strtab.shstrtab.rel.text.data.bss.rel.rodata.comment.note.GNU-stack4 0) %$+$04@ 0 / <+E==Ut ! 4  ( 6F[op z,   .%  " +8 B$T(l A /")CQel* #;Se|(:Qp #Cb? &e x    0 G JdR 4z , ,  F5 F _Tj| Nu s=sr"v9}+;}@Nu(cP~global.c__FUNCTION__.6510global_initany_init_doneforce_fips_modeparse_version_numberparse_version_stringC.23.6663print_configinit_finished.6689no_secure_memorydebug_flagsgpg_errorgcry_errorgpg_err_makegcry_err_makegpg_err_make_from_errnoalloc_funcalloc_secure_funcis_secure_funcrealloc_funcfree_funcoutofcore_handleroutofcore_handler_valueget_no_secure_memorydo_malloc_gcry_ath_init_gcry_initialize_fips_mode_gcry_detect_hw_features_gcry_cipher_init_gcry_md_init_gcry_pk_init_gcry_bug_gcry_global_is_operationalsyslog_gcry_fips_is_operational__ctype_b_loc_gcry_check_versionstrcmp_gcry_mpi_get_hw_config_gcry_get_hw_features_gcry_enforced_fips_mode_gcry_fips_mode_gcry_vcontrol_gcry_private_enable_m_guard_gcry_enable_quick_random_gen_gcry_random_is_faked_gcry_random_dump_stats_gcry_secmem_dump_stats_gcry_secmem_init_gcry_secmem_get_flags_gcry_secmem_term_gcry_secmem_set_flags_gcry_secure_random_alloc_gcry_set_random_seed_file_gcry_update_random_seed_file_gcry_set_log_verbosity_gcry_random_initialize_gcry_ath_install_gcry_fast_random_poll_gcry_set_random_daemon_socket_gcry_use_random_daemonfprintf_gcry_log_info_with_dummy_fp_gcry_fips_test_operational_gcry_is_fips_mode_inactive_gcry_fips_test_error_or_operational_gcry_fips_run_selftests_gcry_random_init_external_test_gcry_random_run_external_test_gcry_random_deinit_external_test_gcry_control_gcry_strerrorgpg_strerror_gcry_strsourcegpg_strsource_gcry_err_code_from_errnogpg_err_code_from_errno_gcry_err_code_to_errno_gcry_err_make_from_errno_gcry_error_from_errno_gcry_set_allocation_handler_gcry_inactivate_fips_mode_gcry_set_outofcore_handler_gcry_log_info_gcry_private_malloc_secure_gcry_private_malloc__errno_location_gcry_malloc_gcry_malloc_secure_gcry_is_secure_gcry_private_is_secure_gcry_check_heap_gcry_realloc_gcry_private_realloc_gcry_free_gcry_private_free_gcry_callocmemset_gcry_calloc_secure_gcry_strdupstrlenstrcpy_gcry_xmalloc_gcry_fatal_error_gcry_xrealloc_gcry_xmalloc_secure_gcry_gettext_gcry_xcalloc_gcry_xcalloc_secure_gcry_xstrdup_gcry_get_debug_flag_gcry_set_progress_handler_gcry_register_pk_dsa_progress_gcry_register_pk_elg_progress_gcry_register_primegen_progress_gcry_register_random_progress!!/7"<#A$O%]&p')*+$+-"4<OWjr./ .>0W1345678!D8I9j:t9;9;9;<=(>?!<CWp@(A@( B8CI@fDEFG1HI!J&*KJ($ Ka ( L MY 2r P R T T T T 1 $ Y, 4 < D L ^ 1i n [x    0     \  6 ]D ^O ^Z ^d T   b$ . T eb ^m ^ ^   g ^ ^ _.id^~`ila`_m+14>Da^kT{o_1a^To#dC1LV\{r^To`^^T on2ib^m^wToqila1%*r;^ETTo_k|1xyz{  $(,048<@DHLPTX\`dhlptx|/71 1249659002 0 1000 100644 23376 ` ELFA4( UEx4EuE;EE< u$E< u$E< u$|E< u$ dE<u$ LEu$4ED$$ED$$m E} U(E}u$*EE EEE}t}t1}tWED$#D$$$E}tmED$#D$$/D$ED$E$EED$#D$$;ED$"D$E$$FEE%EED$ D$#T$$JEE}U}u EUEEEuE$E1E<u!E<uE$EEEEU8}u$- EE}x }} u$-E}u<}u6E UT$ D$D$$E}u%EE}u}tE $EEU D$D$D$ED$ T$D$E$WEEtEE(UE}t E $E$EEUED$$ UE D$E$U} tEE MEEUD$ED$ ED$E D$E$U8}E$EEFEEE܃}t6}t0}t(D$ED$E$EEEEE}uEEUE)ȉEEEm}uE$UD$_D$;$oUD$vD$K$oUD$D$X$oUD$D$h$oUD$D$s$oU8}u E }uE $EEEE<E<EEED$ED$E$EE;EMED$E D$E$,EEEE<u7ED$ED$E$UEEmFE<uE6E<um&EuD$D$$oE}kE‹Ef)fEE$E}u EEEED$ED$E$EEEEE$E]EEEЋED$T$E$<EЋED$T$E$EЋED$T$E$dEEEE<E}E;Er E+E EED$D$JEΉ$EΉ$EE}tPE;Er EEΉD$E$EED$ED$E$EEEED$8D$$oEF} t%E}tE;Er E7E E}tE;Er EEEEEEEU(EEEE}uEE}uEE$NUE}u E+E<(t$‹EEEE} t/E;E r'UE$‹EE}E<:uP} t2EE;E r'UE$‹EE{EEEEEVE9'o@}AB,C6ABD,&]&&C&h#r&Ea&& F!!!/m!,!G!C!A!B!&!"-i"&"F"""/,#*#&#&$,$,$C$A$B5%&`%-%&%&4&B&HP&*&&&&'&**DO+T+Dj,,,-1-*-*-*..D//D//H0%101H2&H23&b5m5Hx5*5N5&566/  $(,048<@DHLPTX\`dhlptx|  $(,048<@DHLPTX\`dhlptx| $(,048<@DHLPTX\`dhlptx|  $(,048<@DHLPTX\`dhlptx|  $(,048<@DHLPTX\`dhlptx|  $(,04/92 1249659002 0 1000 100644 1244 ` ELF4( U]UV4EX5 PXQ1tU}uS1VN[ED$E$ue S[=rIS[Ѓ u%=u% = u%0=0u 4^]UuCentaurHaulsGCC: (GNU) 4.2.2.symtab.strtab.shstrtab.rel.text.data.bss.rodata.comment.note.GNU-stack4 8 %(+(0( 85AGGQP  0q + AH ahwfeatures.chw_featuresdetect_ia32_gnuc_gcry_get_hw_featuresstrcmp_gcry_detect_hw_features_gcry_fips_modeVa k /119 1249659002 0 1000 100644 2604 ` ELF4( U]U}u E~tgE$E}u EUUEEPEEPEEUUEEEE$EEU}u E~tgE$E}u EUUEEPEEPEE̋UEEEE$EEU(EE}uE $EE$EEE EE EE;E r EEE)>E6$B(M2YDeznsy3%X_O ,  d)DRahneq39+EU_1iv+{D 3w l Rsecmem.cptr_into_pool_ppoolpool_sizestats_updatecur_allocedcur_blocksmb_get_nextmb_get_prevmb_mergemb_get_newprint_warnno_warninglock_poolshow_warningnot_lockedinit_pooldisable_secmempool_is_mmappedpool_okaysecmem_locksuspend_warningsecmem_init_gcry_secmem_malloc_internal_gcry_secmem_free_internal_gcry_gettext_gcry_log_infogetuidmlock__errno_locationgeteuidsetuidstrerror_gcry_log_fatal_gcry_log_error_gcry_log_bugsysconfmmapmalloc_gcry_secmem_set_flags_gcry_ath_mutex_lock_gcry_ath_mutex_unlock_gcry_secmem_get_flags_gcry_secmem_init_gcry_fips_mode_gcry_secmem_malloc_gcry_secmem_free_gcry_secmem_reallocmemcpymemset_gcry_private_is_secure_gcry_secmem_termmunmap_gcry_secmem_dump_stats HPU]hpu}:EJ R!`"u#$$%&"%&$'($$$$1'<A)GQiny~*+,$'-2!:DMV^-chq|(/ 0!/&6Uv{0"%&"%&(*/)BG/Y^0k !3 ! hm/0/0/7$ 86 ; 0K ~         # , 2 > ;D N X b u z /      !  0/165 1249659003 0 1000 100644 630 ` ELF4( GCC: (GNU) 4.2.2.symtab.strtab.shstrtab.text.data.bss.comment.note.GNU-stack4!4'4,45FFEp dmissing-string.c/196 1249659004 0 1000 100644 1864 ` ELF4( UEEX=}u E'EEE@;EtEE}u}t E}v}w U EE?EUEE uEE D$$]E}u'$E}u$E}ulE@E@UEBUEB U EPEEUEBEt EEBUE}tUEEUEPEEtEE@BE$UEE$E@;E uE@PEPEE}u֋EUEE2EPE D$$EЅtE@PEPEE}uȋEU}t$E@PEPE@u E$UE@PEP]UEEEE EEE}u} t]E;E}EEEEE EU E@EEEE;E|؋E;E~UEUEEGCC: (GNU) 4.2.2.symtab.strtab.shstrtab.rel.text.data.bss.comment.note.GNU-stack4 ( %$+$0$966I0  @ {J70{AN_w=K 2;Omodule.c_gcry_module_id_new_gcry_module_drop_gcry_module_add_gcry_malloc__errno_locationgpg_err_code_from_errno_gcry_free_gcry_module_lookup_id_gcry_module_lookup_gcry_module_release_gcry_module_use_gcry_module_list   { /219 1249659004 0 1000 100644 9628 ` ELFD4( U(tGt$t t$D$ D$sD$9$@}t1D$ D$zD$9$FD$$]u1BD$ D$D$9$FD$v$E}t|ED$D$$tN$tE$u/:u&E$uuEEt E$[EUHA}t EEE܉$"}tEEES}tEEE}t ElE}t ExEED$ED$ED$E D$ ED$ED$$}tEEES}tEEE}t ElE}t ExEED$ED$ED$E D$ED$ ED$D$$ US4E+EE}U|}t}t }E}t }t}usEj}t }t}uXEO}t}t }t}u7E.}t}t }t}uE }uE}tE}t$tI}t EEE$ËE$UT$ \$D$$}u;E$ËE$\$ D$D$$ @}t}u4E$OËE$B\$ D$D$P$ 4[]UD$$ $     /proc/sys/crypto/fips_enabled_gcry_initialize_fips_modefips.c!done!no_fips_mode_required/etc/gcrypt/fips_enabledr/proc/versionFATAL: error reading `%s' in libgcrypt: %s Libgcrypt error: reading `%s' failed: %s - abortFATAL: failed to create the FSM lock in libgcrypt: %s Libgcrypt error: creating FSM lock failed: %s - abortFATAL: failed to acquire the FSM lock in libgrypt: %s Libgcrypt error: acquiring FSM lock failed: %s - abortFATAL: failed to release the FSM lock in libgrypt: %s Libgcrypt error: releasing FSM lock failed: %s - abort_gcry_inactivate_fips_mode_gcry_fips_mode ()Libgcrypt warning: %s - FIPS mode inactivatedPower-OnInitSelf-TestOperationalErrorFatal-ErrorShutdown?) (OkaycipherdigesthmacpubkeyHMAC-libgcrypt selftest: %s %s%s (%d): %s%s%s%s randomno description available, function fatal %serror in libgcrypt, file %s, line %d%s%s: %s Libgcrypt error: %serror in file %s, line %d%s%s: %sgranteddeniedlibgcrypt state transition %s => %s %s Libgcrypt error: invalid state transition %s => %sLibgcrypt notice: state transition %s => %s  , M n Libgcrypt terminated the applicationGCC: (GNU) 4.2.2.symtab.strtab.shstrtab.rel.text.data.bss.rel.rodata.comment.note.GNU-stack4  %P+$4$0 4%h <EU$P  t  2< Ka t`}9`7fD,,D 7 L< aa xt+ 5Ja zE V_5X R8Q=QXofips.cfsm_lockprocfname.6254__FUNCTION__.6252done.6250fips_new_stateno_fips_mode_requiredenforced_fips_modelock_fsmunlock_fsm__FUNCTION__.6357inactive_fips_modestate2strcurrent_statereporteralgos.6495run_cipher_selftestsalgos.6521run_digest_selftestsalgos.6547run_hmac_selftestsalgos.6573run_pubkey_selftestsrun_random_selftestscheck_binary_integrity_gcry_initialize_fips_mode_gcry_fips_mode_gcry_fips_noreturn_gcry_assert_failedaccessfopenfgetsatoifclose__errno_locationstrerror_gcry_log_infosyslogabort_gcry_ath_mutex_init_gcry_ath_mutex_lock_gcry_ath_mutex_unlock_gcry_enforced_fips_mode_gcry_inactivate_fips_mode_gcry_fips_signal_error_gcry_is_fips_mode_inactive_gcry_fips_is_operational_gcry_fips_run_selftests_gcry_fips_test_operational_gcry_fips_test_error_or_operational_gcry_log_verbositystrcmp_gcry_cipher_algo_name_gcry_md_algo_name_gcry_pk_algo_name_gcry_cipher_selftestgpg_strerror_gcry_md_selftest_gcry_hmac_selftest_gcry_pk_selftest_gcry_random_selftestfflush !("-9IPU#[jz#$#%&+':(?O_fk#v(})$*+*,-.**5:+E*Q],b-jqv%&'(/* +*".,3-BG0[*fk+v*,-!#13$.FR,f!}!.68Y!p!9 "/8MU`:o;:<:<:= :#,4?:R+>?3`hw@?   A3 ?I c     B ?  + E J C^ ?  !- !L !        + + 8 A N W   ,     9    +#,("^j,~,D-|/240 1249659005 0 1000 100644 5464 ` ELF4( UWVSE EEEċE@EȋE@E̋E@ EЋE@EԋE@E؋E@E܋E@EEEEMUEEUEEUEEEEEEE}~EEUTE}~uED$$hËED$$I1‹E 1‹E<ED$$ËED$$1‹E1ЍEE}?!ED$Eԉ$D$ Eԉ$u1D$Eԉ$`1؉UE3E#E3E‹E‹E싄ED$Eĉ$D$ Eĉ$1D$Eĉ$1EȋU!‹E E#E ЍEE܉EE؉E܋EԉE؋EEЉEԋẺEЋEȉE̋EĉEȋEEEăE}?EUċEE@UȋEPE@ŰEPE@ UЋEP E@UԋEPE@U؋EPE@U܋EPE@UEPČ[^_]UEM ȉEE]U(E@($D$D$E$E@ EEEEEEEE@$EE;EsEEEeeE EE@$7=EP$ED)EP$EP$ED)EP$E@$7~tEP$ED)EP$EP$ED)EP$E@$?~D$D$E$E)D$8D$$E‹EPaE‹EPbE‹EPcE‹EPdE‹EPeE‹EPfE‹EPgE‹EPhE)D$E$E)EE‹EEE‹EEE‹EEE‹EEE@‹EEE@‹EEE@‹EEE@‹EEE@‹EEE@‹EEE@‹EEE@‹EEE@ ‹EEE@ ‹EEE@ ‹EEE@ ‹EEE@‹EEE@‹EEE@‹EEE@‹EEE@‹EEE@‹EEE@‹EEE@‹EEE@‹EEE@‹EEE@‹EEE@‹EEE@‹EEE@‹EEE@‹EEE@‹EEUB( B(Ux$E}u E+Eg jE@gE@rnE@($t&EiEE@EEm}uE$U(E EE@($E@$@u.E)D$E$lE@$E@ PEP }E@$$EH$EET)QEP$Em}t E@$?~D$D$E$}tr3ED$E$E@$E@ PEP m@E@}?w$EH$EET)QEP$Em}t E@$?~U(E$E@($D$$E}uE$EEiD$@D$E$E)D$ D$E$E$SE)U)D$ D$$E$} t E E)EEU8D$E$E}u EyED$E$E}uE$EGEE$E}u;E$E$E ED$ED$E$ED$ ED$D$E$E}uE$E$t"E$E$EE$ED$E$E}uE$EQE;E vE$E*ED$ED$E$E$EE܋E/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqrbGCC: (GNU) 4.2.2.symtab.strtab.shstrtab.rel.text.data.bss.rodata.comment.note.GNU-stack4  ` %T+T0` 8cAuuQ    ll 5)W :>EWW^ej L t hmac256.cK.3359transformrorfinalize_gcry_hmac256_updatememset_gcry_hmac256_newmallocmemcpyfree_gcry_hmac256_release_gcry_hmac256_finalize_gcry_hmac256_filefopenfclosefreadferror__errno_location'   w  "  J j u   Q        H S ~       &  G [ f u       /264 1249659005 0 1000 100644 4088 ` ELF4( UEXt2$t $ЉE}tEE($ЉEEEEUWV} E}tEEXuEt E< %t3Et* E9u ЋE%9t E<gE^}tGE@tE@t E@u E-1E X XEE^_]UE} t0$ЋEt} u(U$ЉE} t4$ЋEUXtD$E$EEEEUXtd,u E0$ЋEu4$E^4$Ћ,E$҉E=Et$D$ D$D$$EEEU(Xt6D$E$E}tEEO0U$ЉE=Et$D$ 9D$D$$EEEU(Xt6D$E$ E}tEEP4U$ЉE>Et$D$ ND$D$$eEEEUXt*8t!8ED$E D$E$҉EED$E D$E$EEUXt*<t!<ED$E D$E$҉EED$E D$E$EEUXt8@t/@ED$ED$ ED$E D$E$҉E*ED$ED$ ED$E D$E$EEUXt*Dt!DED$E D$E$҉EED$E D$E$EEUXt*Ht!HED$E D$E$҉EU ED$T$E$EEUXt*Lt!LED$E D$E$҉EU ED$T$E$EEUXt*Pt!PED$E D$E$҉EED$E D$E$EEUXt*Tt!TED$E D$E$҉EED$E D$E$EE_gcry_ath_mutex_destroyath.c*lock == ((ath_mutex_t) 0)_gcry_ath_mutex_lock_gcry_ath_mutex_unlock*lock == ((ath_mutex_t) 1)GCC: (GNU) 4.2.2.symtab.strtab.shstrtab.rel.text.data.bss.rodata.comment.note.GNU-stack4 X %+\ 08`ArrQ| `   X 8#SY.G9`NySS<$ZZ%+`v<CZU]0ZnuZZ>Zath.ccheck_init_lockops_setopsmutex_init__PRETTY_FUNCTION__.4111__PRETTY_FUNCTION__.4135__PRETTY_FUNCTION__.4153_gcry_ath_init_gcry_ath_install_gcry_ath_mutex_init_gcry_ath_mutex_destroy__assert_fail_gcry_ath_mutex_lock_gcry_ath_mutex_unlock_gcry_ath_readread_gcry_ath_writewrite_gcry_ath_selectselect_gcry_ath_waitpidwaitpid_gcry_ath_acceptaccept_gcry_ath_connectconnect_gcry_ath_sendmsgsendmsg_gcry_ath_recvmsgrecvmsg 8?{.:gn $+;BJh x     +Xw     Tgpz$7@J~!2#ENX%cipher.o/ 1249659006 0 0 100644 24520 ` ELFL94(  U]USD$D$$USD$D$$US1D$D$$USFD$D$$UVS0EE[E@uEBE@uE BE@ uE<B E@$uEnB$E@(uEB(tED tTELE4EDD$L$ t$D$ $EE}uE}t [D$D$5$0[^]US4EEE EE@EED$E$E}tIE*EED$E$EEEEt}tE4[]US4EEE EE@EE}tGE)EED$E$uEEEEt}t‹E4[]US$ D$ED$$EE$[]US$ ;D$ED$$EE$[]US4Et$<E$} tE E EED$ED$ ED$D$ $E$}uUEE@‹EE$UEE4[]UED$$U} tEE MEEUED$$ UE D$E$US$E$$[]US$E}tFD$sD$E$t!D$xD$E$uEE$E}E@EEdEPED$E$u<} t E@‹E }tEPEPMQEEEPEt}tE$E$[]US$E}u E$uǃ$$D$ED$E$VE}u(E$BE}tE@EE$$EEE$[]US$EE}u EK$ED$D$E$E}tEE$EEE$[]US$$uiǃ$$E D$$E}tE@EE$ }E$E$[]UE$DUS$$uǃ$$E D$$E}t)E@uE@ƒEPE$$$[]US$E$uǃ$$E D$$E}t!E@tE E$E $E$[]US$E$u;ǃ$$E D$$E}tHE@@E}uED$$E$$EEED$$E$[]US$E$u[ǃ$$E D$$E}tHE@@ E}uED$$E$$EEED$$E$[]US4EEEEEEE$uQǃ$$E D$$E}t5E@tE E$E@EE@ EE $}uEtE }}EEP 9tEP <9u[EGREP$n9tEP(9u2EG)u$uEGEG}8E@E}tED$$EED$$E}u$EEEtEƒ)ЉEUEE}t EBFEd $EUԉUE)щʋEPUEBUEB UEBUEBUE BUEB,UEB0E w0U싃BU싃B U싃B$U싃B(}t-}t'$E$$}uEEEEU؉E$4[]US$}E=BFt"E=d $tD$$?E$E@$$E@EEEE@EEEm}uEU)Љ$$[]UVS E@ HUpED$E D$$щE}u1E@ HupUpE@ @L$t$$E$ [^]USE@ @ U4D$D$$} E@ @ ;EtTE@ @ D$ED$$$PD$D$ D$D$$E@ @ ;Es E@ @ EE4UT$U T$$E@T[]USE@ HUpE@ @UpL$D$$E@ @ U4D$D$$E@ @ UDD$D$$E@ @ UXD$D$$[]U(E>E@ HUpED$E D$$ыE@ @ EE@ @ E EE;ErU(E>E@ H UpED$E D$$ыE@ @ EE@ @ E EE;ErUVS@E@ @ EEuEE@0tE;EvEuЅumE@$tgEp$E@0U4MpD$ED$ED$ E D$T$ $֋EEEE@0EEE EE4EE#EM EEE0ЈEEE;ErՋE@ HUpE D$E D$$ыU4ED$E D$$EEE@0uEE EE;E\E@0E;EEuЅuEEEuЉEE)E E4EE=EEEEEU EE EU E2EEEE;E|EU EEEE;ErE@ HUpE D$E D$$ыU4ED$E D$$@[^]UVS@E@ @ EEuEE@0t@E;Ev8mEuЅumE4MDUT$D$ $E@(tIEp(U4MpED$ED$ E D$T$ $֋EEEEEE EUDED$ED$$E@ H UpED$E D$$ыE4EE#EM EE E0ЈEEE;ErՋUDM4ED$T$ $E@ @ EE@ @ E EE;E>E@0yE;EmEuЅuEEEuЉEU4MDED$T$ $MEEU4L$D$$E@ H UpED$E D$$ыE4EE#EM EE E0ЈEEE;E|ՋUEM T$E D$ $EEMEE ET4EE;ErE@ H E4UpD$E D$$ыEDEE#EM EE E0ЈEEE;ErՃ@[^]UVS@E@ @ EEEEE@T;ErdU4E@ @ ‹E@T)ȉE7U E0ȈE E EEmE@TPEPT}uE@TtbE@T)EU4E‹E@T)ȉE3U E0ȈE E EEE@TPEPTE@TuËE;EE@EuEEpU4MpED$ED$ E D$T$ $֋EEE EEEEE)ExE@ pE4U4MpD$T$ $֋E4EE(U E0ȈE E EEEE;ErЋE)EE;EsE;EU4MDED$T$ $E@ pE4U4MpD$T$ $֋E4EE(U E0ȈE E EEEE;ErЋE)E}U4MDED$T$ $E@ pE4U4MpD$T$ $֋UEPTE@T+E‹EPTE4E(U E0ȈE E EEm}u҃@[^]UVS@E@ @ EEEEE@T;ErlU4E‹E@T)ȉEEEEEEE0‹E E E‹EEmE@TPEPT}uE@TtpE@T)EU4E‹E@T)ȉEAEEEEE0‹E E E‹EEE@TPEPTE@TuE;EE@ EuEEp U4MpED$ED$ E D$T$ $֋EEE EEEEE)EE@ pE4U4MpD$T$ $֋E4EE6EEEEE0‹E E E‹EEEE;Er‹E)EE;EvE;EU4MDED$T$ $E@ pE4U4MpD$T$ $֋E4EE6EEEEE0‹E E E‹EEEE;Er‹E)E}U4MDED$T$ $E@ pE4U4MpD$T$ $֋UEPTE@T+E‹EPTE4E6EEEEE0‹E E E‹EEm}uă@[^]UVS E@ @ EE@T;Er_U4E@ @ ‹E@T)ȉE2EE0‹E E EEmE@TPEPT}uE@TE@T)EU4E‹E@T)ȉE.EE0‹E E EEE@TPEPTE@TuU4MDED$T$ $E@ pE4U4MpD$T$ $֋E4EE#EE0‹E E EEEE;ErՋE)EE;Ej}U4MDED$T$ $E@ pE4U4MpD$T$ $֋UEPTE@T+E‹EPTE4E#EE0‹E E EEm}u׃ [^]UVS E@ @ EE@T;ErYU4E‹E@T)ȉE2EE0‹E E EEmE@TPEPT}uE@TE@T)EU4E‹E@T)ȉE.EE0‹E E EEE@TPEPTE@TuU4MDED$T$ $E@ pE4U4MpD$T$ $֋E4EE#EE0‹E E EEEE;ErՋE)EE;Ej}U4MDED$T$ $E@ pE4U4MpD$T$ $֋UEPTE@T+E‹EPTE4E#EE0‹E E EEm}u׃ [^]UWV0EE@ P EѺЅugE@ HEXUpD$ED$$ыE@ @ E.MEDXPETXUEDXu m}̋Eu EEE@ P E׺D0ȈEE;E=0^_]UED$ ED$E D$E$US4EE@,E}EEE@ P EѺЅu7E@ P EѺD$ ED$E D$E$E-E@ P EѺЅtE@ @ ;Es2E@0t%ED$ ED$E D$E$<8E-,ED$ ED$E D$E$ED$ ED$E D$E$MED$ ED$E D$E$E@ P$MpED$ ED$E D$ $u$u;D$D$ uD$D$$EG;E;E t3ED$ED$E $E@,D$$E4[]US$}u(U M ED$ T$L$E$EE@0tE@ @ EEEM;Mv EBxE@,t&E@,u?E@0tE@ @ ;Er$E@ P EѺЅt E-#UM ED$ T$L$E$E}t } tED$D$BE $E$3$[]US4EE@,E}EEE@ P EѺЅu7E@ P EѺD$ ED$E D$E$E-E@ P EѺЅtE@ @ ;Es2E@0t%ED$ ED$E D$E$d8E-,ED$ ED$E D$E$ED$ ED$E D$E$(ED$ ED$E D$E$E@ P(MpED$ ED$E D$ $u$u;D$D$ D$D$$EG;E;E t3ED$ED$E $E@,D$$E4[]U(E}u(U M ED$ T$L$E$EE;Es EBxE@,t&E@,u?E@0tE@ @ ;Er$E@ P EѺЅt E-#UM ED$ T$L$E$EE$%UVSE@0E@Tt}E@ P E@T)u4U4E@TL$t$$E@TUDE@ @ ‹E@T)ƉU4L$D$$E@T[^]UU ED$T$E$2UU ED$T$E$US} t2E@ @ ;Eu$E@ @ UXD$E D$$B} t}u%E@ @ UXD$D$$$-ZEEE[]US$E} >E XUED$T$E$ EEUT$D$E$E$WqE$a}t/E@0t EHBE@0ƒEP0,E@0ƒEP0}t/E@0t EHE@0ƒEP0E@0ƒEP0}u }t}t$ FEE$}t5E@ @ ;Eu'E@ @ UXD$ED$$X}t}u(E@ @ UXD$D$$$E-E@@t4E@PEpD$ D$D$$҉EE<E@ @ ;Ev EBEEE@TE}u E@ @ EUE@ @ 9v*,D$ D$D$=$E‹EEU4E@ @ ‹E)ȉEEEEEm}uE=E$EE$[]UEE=E$cUEE E}tb}}t}u}u E E$&E}t}wEEzE q}u}u E \E$E}t}'w UE5E ,}u}t E-E$EE=E$jU(ED$ D$D$E$tEEU(ED$ D$D$E$tEEUSE$uIǃ$E[]US$E$ E D$ED$$E$E$[]US4EEE$uǃ$$E D$$E}tE@u E@ E$}t)Et EED$E D$E$҉EqE }td}t E@t"}t TE gEEE {EED$ D$ED$$EЃ}t'$E$$E$w4[].-  /01235678dummy_encrypt_blockcipher.cdummy_decrypt_blockdummy_encrypt_streamdummy_decrypt_streamcipher_register_defaultoid.OID.?cipher %d w/o key length cipher %d not found cipher %d w/o blocksize gcry_cipher_close: already closed/invalid handlecipher_setivWARNING: cipher_setiv: ivlen=%u blklen=%u IV length does not match blocklengthcipher_encryptcipher mode NONE usedcipher_encrypt: invalid mode %d cipher_decryptcipher_decrypt: invalid mode %d _gcry_cipher_ctln <= h->cipher->blocksizealgorithm disabledalgorithm not foundno selftest availablemodulecipherGCC: (GNU) 4.2.2$.symtab.strtab.shstrtab.rel.text.data.bss.rel.data.rel.rel.rodata.comment.text.__i686.get_pc_thunk.bx.note.GNU-stack.group4o<3 hP %3+3430 0 \ B5> (]J8S8p88;@ Y  FY  0(@ M_ 2s<21n2F2[ $A;]=u=K.f":  a 0A E+S erEWWu,9Z5!/#$(u'$96H(9W(+c,  u {L u e&%%a%7&%&)](")()G)l)/,-A-1--Q-- ... 8Nj%>\v<Zx 91?I^f|! I%2C[mj   &!5 W*J +!^ +&q !, ,   /! / 08 18 S1W 1]1 C 2cipher.ccipher_tabledummy_extra_specciphers_registered_lockdummy_setkey__FUNCTION__.5784dummy_encrypt_block__FUNCTION__.5790dummy_decrypt_block__FUNCTION__.5797dummy_encrypt_stream__FUNCTION__.5804dummy_decrypt_stream__FUNCTION__.5814cipher_register_defaultciphers_registeredgcry_cipher_lookup_func_namegcry_cipher_lookup_func_oidgcry_cipher_lookup_namegcry_cipher_lookup_oidgpg_errorgcry_errorgpg_err_makegcry_err_makesearch_oiddefault_ciphers_registeredcipher_algo_to_stringdisable_cipher_algocheck_cipher_algocipher_get_keylencipher_get_blocksizecipher_setkey__FUNCTION__.6321cipher_setivcipher_resetdo_ecb_encryptdo_ecb_decryptdo_cbc_encryptdo_cbc_decryptdo_cfb_encryptdo_cfb_decryptdo_ofb_encryptdo_ofb_decryptdo_ctr_encryptdo_ctr_decrypt__FUNCTION__.7120cipher_encrypt__FUNCTION__.7223cipher_decryptcipher_sync__FUNCTION__.7395.L167.L168.L169.L407.L408.L409.L410.L411.L412.L413.L451.L452.L453.L454.L455.L456.L457.L507.L508.L509.L510.L511.L512.L513.L514.L515.L516.L517_gcry_cipher_spec_blowfish_gcry_cipher_spec_des_gcry_cipher_spec_tripledes_gcry_cipher_extraspec_tripledes_gcry_cipher_spec_arcfour_gcry_cipher_spec_cast5_gcry_cipher_spec_aes_gcry_cipher_extraspec_aes_gcry_cipher_spec_aes192_gcry_cipher_extraspec_aes192_gcry_cipher_spec_aes256_gcry_cipher_extraspec_aes256_gcry_cipher_spec_twofish_gcry_cipher_spec_twofish128_gcry_cipher_spec_serpent128_gcry_cipher_spec_serpent192_gcry_cipher_spec_serpent256_gcry_cipher_spec_rfc2268_40_gcry_cipher_spec_seed_gcry_cipher_spec_camellia128_gcry_cipher_spec_camellia192_gcry_cipher_spec_camellia256__i686.get_pc_thunk.bx_GLOBAL_OFFSET_TABLE__gcry_bug_gcry_fips_mode_gcry_module_addstrcasecmp_gcry_module_lookup_gcry_cipher_register_gcry_ath_mutex_lock_gcry_ath_mutex_unlock_gcry_cipher_unregister_gcry_module_releasestrncmp_gcry_cipher_map_name_gcry_cipher_mode_from_oid_gcry_module_lookup_id_gcry_cipher_algo_name_gcry_log_bug_gcry_cipher_open_gcry_fast_random_poll_gcry_get_debug_flag_gcry_calloc_secure_gcry_calloc__errno_locationgpg_err_code_from_errno_gcry_aes_cfb_enc_gcry_aes_cfb_dec_gcry_aes_cbc_enc_gcry_aes_cbc_dec_gcry_cipher_close_gcry_fatal_error_gcry_freememcpymemset_gcry_log_info_gcry_fips_signal_errormemmove_gcry_log_fatal_gcry_cipher_encrypt_gcry_cipher_decrypt_gcry_cipher_setkey_gcry_cipher_setiv_gcry_cipher_setctr_gcry_cipher_ctl_gcry_assert_failed_gcry_cipher_info_gcry_cipher_algo_info_gcry_cipher_get_algo_keylen_gcry_cipher_get_algo_blklen_gcry_cipher_init_gcry_cipher_list_gcry_module_list_gcry_cipher_selftesto p 0 8qDoJ pP b jqvo| p qo p qo p   + A M Y o {       r    @ Hs^ x  qo pt tCoI pto p  uo  p  )uAoG pSrq yw  s xo p wz xo p {  {jtzo p w + 5 =xC Kwz xo p w 'xBoH pN Vw\ k u }x w ~z  x o p  w ) 3 ; xA I wR ^ ~ z  x o p  w    x  w  ~= zL T xi oo p|  w    x  w  ~  z  x, 4 I oO p\ d wj y   x  w  ~  z  x  ) o/ p` f n wt    x  w  ~ z  xD T d }   r   $ w*z0 8xrox p  wz x!4o: po p  / A Io p;o p>j~o pfq o pTo pcoi pn !!o! p"=#$o$ p$ f&rv&& & & &&& &'o ' p (&(o,( pU( )r)) ) ) *0*B* J*1+o7+ p++),o/, pe,,,o, p, Q..7/ I/ S/ [/1?1[1oa1 pn1 v1w|1 1 1 1x1o1 p1 1w1 11 1x2o2 p02 82w>2 M2 W2 _2xe2 m2wv2 2~2 2x 3 3 &3 63 G3 [3 c3wn3zt3 |3xYZ [$\0]4@^DP_T``adbpctdefghijklmn ; < < < = < < > ? @ A B C D E F G H  I$ J( KX L\ M` Nd Oh Pl Lp Lt Lx L| L L L Q L L L L L L L L L L L L L L L L L L L L L L L L L L L L R S T L  L L L L L  L$ L( L, L0 L4 L8 L< L@ LD LH LL UP Vmd5.o/ 1249659006 0 0 100644 6656 ` ELF4(  UEEE#EgE@E@ܺE@ vT2E@E@TUStEEE@EE@EE@ EEED$@E D$E$E3E#EU1‹EE-[(EED$E$EMME3E#EU1‹EE-H8EED$ E$EMME3E#EU1‹EEp $EED$E$rEMME3E#EU1‹EE-1B>EED$E$1EMME3E#EU1‹EE-Q EED$E$ EMME3E#EU1‹EE*ƇGEED$ E$ EMME3E#EU1‹EE-WEED$E$n EMME3E#EU1‹EE-jEED$E$- EMME3E#EU1‹EEؘiEED$E$ EMME3E#EU1‹EE-QtEED$ E$ EMME3E#EU1‹EE-OEED$E$j EMME3E#EU1‹EE-B(vEED$E$) EMME3E#EU1‹EE"kEED$E$ EMME3E#EU1‹EE-mgEED$ E$ EMME3E#EU1‹EE-rYEED$E$f EMME3E#EU1‹EE!IEED$E$% EMME3E#EU1‹EE- ED$E$ EMME3E#EU1‹EЍE-L?ED$ E$ EMME3E#EU1‹EEQZ^&ED$E$t EMME3E#EU1‹EE-V8IED$E$9 EMME3E#EU1‹E̍E-)ED$E$ EMME3E#EU1‹EESDED$ E$ EMME3E#EU1‹EE-^'ED$E$ EMME3E#EU1‹EȍE-8,ED$E$M EMME3E#EU1‹E܍E!ED$E$ EMME3E#EU1‹EE-*>  IIS(02A;?    L cy (md5.cmd5_inittransformrolmd5_writemd5_finalmd5_readasnoid_spec_md5__i686.get_pc_thunk.bx_GLOBAL_OFFSET_TABLE_memcpy_gcry_burn_stackmemset_gcry_digest_spec_md5QW  #8> h   $, 48<@primegen.o/ 1249659006 0 0 100644 22720 ` ELF <4(   US$EEE@tEEE}u}uf}dv`EEHMUE諪E9r$E@$E@}uEEEE}u}u>D$$E}u E$9UE쉃UEBE$‹EPUE B $[]US$E}E@tkE@;Eu`E@ ;E uUE@EE@E$;Et*D$ D$D$$EEEE}yEE$[]UEE ]USt2D$D$ ED$CD$ $҃[]U(U ED$ED$ T$D$E$E$ oEU(U ED$ED$ T$D$E$E$ -EUVSEEEEEEEEEEEEEEE$EEEEE}/w E-8} FE E}uUEEEEEEEUE)Ѓu;Esm$EЃ}t }t}w E- }t;mE̍E)ЃuEŰE)щʋEE)ȉE'ŰE)ЃuEEUE)ЉE$t1ED$ED$ED$ ẺD$ED$L$E$EċE UD$D$ D$T$E$V E}t,E UD$D$ D$T$Ẻ$$ EED$$E}u$E E$E}u$E EEEEE;ErUЃE}tE}wED$E$E}u$E EEEEE;Er}E(EE$EEEE;ErЋED$$E}u$E| $t E?^ EEEEEE}tUEuED$E$EEu%$t E?EEEu8EuED$D$ D$D$E$ EUEEUEEEE;E }t$t E?0EEUMD$T$ $W$t E?EEEEEEEEu[}tUEuED$E$EEu%$t E?_EEEu8EuED$D$ D$D$E$9 EUEEUEEEEE;Es E;E}t$t E?EE;Eu#E$E$!Z\ED$Eĉ$D$EĉD$Eĉ$}tED$EĉD$Eĉ$E&EED$EĉD$Eĉ$EE;ErD$EĉD$Eĉ$Eĉ$EȋE;Es]E}vZEE$>E$E UD$D$ D$T$E$EMEE;Ev]E}vZEm$<E$E UD$D$ D$T$E$'EEE;EE0D$E,D$ D$EЉD$Eĉ$k $#$ wEĉD${$ED$$}tED$$E"EED$$EE;Er֋E$ƋEĉ$t$D$$}tE$D$$E1EE$D$ED$$EE;Er$ `}wED$$E}u$E>}(EEuD$$EEuE$E}tEuE$EE*EuEE$EEE;ErE}tuEuE$E&EuEE$EE;Ev.EuEE$EE;Er҃}Eċ@$EEċ@$EEċ@$E}t EEEUEUE4$D$EĉD$E$D$E$D$ED$E$$t)$E$$ $^E]EED$ED$E$EĉD$ ED$ED$E$D$E$tEE;Ew$t $ HE;EUE$E$E$E$$u $ }$EEyEEteEEE;Et EE;ErE;Eu#}tEEED$$fEE$EE;E{}t$tE?EE$E$}t E$}t E$EЉ$E$E$}uU Eĉ}tWUEM}t$ED$N$`D$`$}t`EDž`}tUEE} tU E}$t6}(t0ED$ED$Ẻ$U$ẺEU(E},tU,EԉE$E$E$E$`$Ẻ$EЉ$EȉTT[^] %)+/5;=CGIOSYaegkmq %379=KQ[]agou{  #-39;AKQWY_eikw)+57;=GUY[_mqsw %'-?CEIOU]ci  ')/QW]ew #+/=AGIMSU[ey '7EKOQUWamsy!#')3?AQSY]_iq   # % + / 5 C I M O U Y _ k q w   ! 1 9 = I W a c g o u {      # ) - ? G Q W ] e o {   % / 1 A [ _ a m s w      ! + - = ? O U i y !'/5;KWY]kqu}  %)1CGMOSY[gk!%+9=?Qisy{ '-9EGY_cio #)+17AGS_qsy} '-7CEIOW]gim{get_pool_primeprimegen.cnbits == _gcry_mpi_get_nbits ((prime))primegengen prime: pbits=%u qbits=%u fbits=%u/%u n=%d prime : factor q: factor q0: factor pi: bit sizes: prime=%u, q=%u, q0=%u, p%d=%uchecking g: can't generate a prime with less than %d bits overflow in prime generation is_prime_gcry_mpi_cmp ((x),(nminus1)) < 0 && _gcry_mpi_cmp_ui ((x),(1)) > 0m_out_of_n_gcry_generate_fips186_3_primeqbits/8 <= sizeof digest_gcry_md_get_algo_dlen (hashalgo) == qbits/8seedlen <= sizeof seed_help_bufferfips186-3 pbits p=%u q=%u counter=%d fips186-3 seed:fips186-3 prime pfips186-3 prime qGCC: (GNU) 4.2.2 $Ë$.symtab.strtab.shstrtab.rel.text.data.bss.rodata.comment.text.__i686.get_pc_thunk.cx.text.__i686.get_pc_thunk.bx.note.GNU-stack.group4 +< #Dx3 pLP %3@ +9 09r8r;A;^;{;;x># hE : <:IYkzT6[L1  F.(a6"F+ S   e |" EB7BSj'8FWizy$2AVj!+j@{yR6n*"Z$#7[& $7>Sbz,sprimegen.csmall_prime_numbersno_of_small_prime_numbersprimepool_locksave_pool_prime__FUNCTION__.5957get_pool_primeprogress_cbprogress_cb_dataprogressgen_primeprime_generate_internalm_out_of_ncheck_primeis_prime__FUNCTION__.6689__FUNCTION__.6763gpg_errorgcry_errorgpg_err_makegcry_err_makefind_x931_primegpg_err_code__FUNCTION__.7297__i686.get_pc_thunk.bx_GLOBAL_OFFSET_TABLE_primepool_gcry_mpi_release_gcry_calloc_gcry_mpi_get_nbits_gcry_assert_failed_gcry_register_primegen_progress__i686.get_pc_thunk.cx_gcry_generate_secret_prime_gcry_generate_public_prime_gcry_mpi_alloc_set_ui_gcry_get_debug_flag_gcry_log_debug_gcry_mpi_new__errno_locationgpg_err_code_from_errno_gcry_malloc_gcry_mpi_free_gcry_ath_mutex_lock_gcry_ath_mutex_unlock_gcry_free_gcry_mpi_set_gcry_mpi_mul_ui_gcry_mpi_mul_gcry_mpi_add_ui_gcry_log_mpidump_gcry_mpi_set_ui_gcry_mpi_copy_gcry_mpi_alloc_gcry_mpi_sub_ui_gcry_mpi_dump_gcry_log_printf_gcry_mpi_fdiv_q_gcry_mpi_powm_gcry_mpi_cmp_ui_gcry_generate_elg_prime_gcry_log_fatal_gcry_xmalloc_gcry_mpi_snew_gcry_mpi_alloc_like_gcry_mpi_randomize_gcry_mpi_set_highbit_gcry_mpi_set_bit_gcry_mpi_fdiv_r_ui_gcry_mpi_test_bit_gcry_mpi_divisible_ui_gcry_mpi_trailing_zeros_gcry_mpi_tdiv_q_2exp_gcry_mpi_clear_bit_gcry_mpi_cmp_gcry_bug_gcry_prime_generate_gcry_prime_check_gcry_prime_group_generator_gcry_prime_release_factors_gcry_derive_x931_prime_gcry_mpi_invm_gcry_mpi_sub_gcry_mpi_add_gcry_mpi_subm_gcry_mpi_gcd_gcry_generate_fips186_2_primegpg_err_code_from_syserror_gcry_create_noncememcpy_gcry_md_hash_buffer_gcry_mpi_scan_gcry_mpi_clear_highbit_gcry_mpi_lshift_gcry_mpi_mul_2exp_gcry_mpi_mod_gcry_generate_fips186_3_prime_gcry_md_algo_info_gcry_md_get_algo_dlen_gcry_log_printhex# $ %U %&'& % %(##) $/ %r(}   )+ $  # $   2 # $.p/ 01''52?3V4d2n3'23@5o'}23 6 7 7 6 7N V 7 8 9 : ; ;4 <? (v 5 5b / = = = = ( (  0- (7 ? 0\ (m u 0 ' 2 3 > ?> ?m ? ? ??&@7@H@.A></ 0B CCDcEvF/5555/ #65 788 88%505;5|585?#E $Y aHg sI..J1KKKL*MENXNO  ?<bAEFP 015<5G5R5]5h8# $Q  #K1KNAnEy5F55T#Z $h@y@@@.(A?RSP>oLPMMTUF   )@ESFmUEFUU5"5-585C5N5d#j $   $Vr#x $s558# $.5# $ 1 1, 1@ ?Y > A!<!/(! 0!0;!BA! I!0!D!E!F!/!&"&"&2"#8" $["5z"8"#" $"."?"N"<#5,##2# $i#P#K#;#K#\#; $K)$\B$;[$]~$^$_$^$5$U$^ %.%K5%AO%Ah%`%<%^%5%5&5-&5H&5f&#l& $&4'b'.I'1W'1y'c'd'e (eD(&u(f(M(N(1)>r)e})&)f)g)h*^6*>K*Md*^~*i*j*A*]*(+d+&+&+&+&+&+8+&,#, $,l- "- ,- 4-)?-mQ- c- m- u-)-4-b-.-1-1?. Q. [. c.)u.c.e/&E0eP0&0f0g0h0^ 1>1M71^T1im1j1A1]1(2(2(22 :20N2 V2nc2 k2={2 2=2d3&!3&,3&73&E3&P38[3&twofish.o/ 1249659006 0 0 100644 53692 ` ELF̥4(  USDEEEEEEEEEEEEEEEEEt E,ku7ǃtD$$t E2hkE t\E EE0EE-0EE0EE-0EE tfE EE-0EE0EED0EE0EE tjE EE0EE0EE0EE0EE tfE EE0EE0EE=0EE0EE tfE EE0EEF0EEf0EE0EE tfE EE0EE<0EE[0EE0EE tfE EE0EE70EEO0EE0EE thE EE0EE0EE0EE0EE t_E EE0EE-0EE0EE-0EE tfE EE-0EE0EED0EE0EE tjE EE0EE0EE0EE0EE tfE EE0EE0EE=0EE0EE tfE EE0EEF0EEf0EE0EE tfE EE0EE<0EE[0EE0EE tfE EE0EE70EEO0EE0EE thE EE0EE0EE0EE0E} CE t_E EE0EE-0EE0EE-0EE tfE EE-0EE0EED0EE0EE tjE EE0EE0EE0EE0EE tfE EE0EE0EE=0EE0EE tfE EE0EEF0EEf0EE0EE tfE EE0EE<0EE[0EE0EE tfE EE0EE70EEO0EE0EE thE EE0EE0EE0EE0EE t_E EE0EE-0EE0EE-0EE tfE EE-0EE0EED0EE0EE tjE EE0EE0EE0EE0EE tfE EE0EE0EE=0EE0EE tfE EE0EEF0EEf0EE0EE tfE EE0EE<0EE[0EE0EE tfE EE0EE70EEO0EE0EE thE EE0EE0EE0EE0EEE؉EEDMԋE2E2E2E2EEMԋE2E2E2E2EEMԋE2E2E2E2E EMԋE2E2E2E2EE EEE}E 4uE 0E 0E 0E 4E 0E 0E 01E 4E 0E 0E 0 1E 4uE 0E 0E 01ȉEE 4E 0E 0E 0E 4gE 0E 0E 01E 4gE 0E 0E 0 1E 4E 0E 0E 01ȉEMEEEEUEEEE 4E 0E 0E 0E 4E 0E 0E 01E 4E 0E 0E 0 1E 4E 0E 0E 01ȉEE 4E 0E 0E 0E 4E 0E 0E 01E 4E 0E 0E 0 1E 4E 0E 0E 01ȉEMEEEEUEEE E 4E 0E 0E 0E 4E 0E 0E 01E 4E 0E 0E 0 1E 4E 0E 0E 01ȉEE 4{E 0E 0E 0E 4E 0E 0E 01E 4E 0E 0E 0 1E 4{E 0E 0E 01ȉEMEEEEUEEEE 4E 0E 0E 0E 4E 0E 0E 01E 4E 0E 0E 0 1E 4E 0E 0E 01ȉEE 4E 0E 0E 0E 4vE 0E 0E 01E 4vE 0E 0E 0 1E 4E 0E 0E 01ȉEMEEEEUEEEE 4JE 0E 0E 0E 4E 0E 0E 01E 4E 0E 0E 0 1E 4JE 0E 0E 01ȉEE 4E 0E 0E 0E 4E 0E 0E 01E 4E 0E 0E 0 1E 4E 0E 0E 01ȉEMEEEEUE EE$E 4E 0E 0E 0E 4E 0E 0E 01E 4E 0E 0E 0 1E 4E 0E 0E 01ȉEE 4kE 0E 0E 0E 4xE 0E 0E 01E 4xE 0E 0E 0 1E 4kE 0E 0E 01ȉEMEEEEUE(EE,E 4EE 0E 0E 0E 4E 0E 0E 01E 4E 0E 0E 0 1E 4EE 0E 0E 01ȉEE 4}E 0E 0E 0E 4E 0E 0E 01E 4E 0E 0E 0 1E 4}E 0E 0E 01ȉEMEEEEUE0EE4E 4E 0E 0E 0E 4E 0E 0E 01E 4E 0E 0E 0 1E 4E 0E 0E 01ȉEE 4KE 0E 0E 0E 48E 0E 0E 01E 48E 0E 0E 0 1E 4KE 0E 0E 01ȉEMEEEEUE8EE<E 4E 0E 0E 0E 4 E 0E 0E 01E 4 E 0E 0E 0 1E 4E 0E 0E 01ȉEE 42E 0E 0E 0E 4E 0E 0E 01E 4E 0E 0E 0 1E 42E 0E 0E 01ȉEMEEEEUE@EEDE 4E 0E 0E 0E 45E 0E 0E 01E 45E 0E 0E 0 1E 4E 0E 0E 01ȉEE 4E 0E 0E 0E 4E 0E 0E 01E 4E 0E 0E 0 1E 4E 0E 0E 01ȉEMEEEEUEHEELE 47E 0E 0E 0E 4E 0E 0E 01E 4E 0E 0E 0 1E 47E 0E 0E 01ȉEE 4qE 0E 0E 0E 4E 0E 0E 01E 4E 0E 0E 0 1E 4qE 0E 0E 01ȉEMEEEEUEPEETE 4E 0E 0E 0E 4E 0E 0E 01E 4E 0E 0E 0 1E 4E 0E 0E 01ȉEE 4E 0E 0E 0E 4lE 0E 0E 01E 4lE 0E 0E 0 1E 4E 0E 0E 01ȉEMEEEEUEXEE\E 40E 0E 0E 0E 4CE 0E 0E 01E 4CE 0E 0E 0 1E 40E 0E 0E 01ȉEE 4E 0E 0E 0E 4uE 0E 0E 01E 4uE 0E 0E 0 1E 4E 0E 0E 01ȉEMEEEEUE`EEdE 4E 0E 0E 0E 47E 0E 0E 01E 47E 0E 0E 0 1E 4E 0E 0E 01ȉEE 4E 0E 0E 0E 4&E 0E 0E 01E 4&E 0E 0E 0 1E 4E 0E 0E 01ȉEMEEEEUEhEElE 4E 0E 0E 0E 4E 0E 0E 01E 4E 0E 0E 0 1E 4E 0E 0E 01ȉEE 4E 0E 0E 0E 4E 0E 0E 01E 4E 0E 0E 0 1E 4E 0E 0E 01ȉEMEEEEUEpEEtE 4E 0E 0E 0E 4E 0E 0E 01E 4E 0E 0E 0 1E 4E 0E 0E 01ȉEE 4?E 0E 0E 0E 4HE 0E 0E 01E 4HE 0E 0E 0 1E 4?E 0E 0E 01ȉEMEEEEUExEE|E 4^E 0E 0E 0E 4E 0E 0E 01E 4E 0E 0E 0 1E 4^E 0E 0E 01ȉEE 4E 0E 0E 0E 4E 0E 0E 01E 4E 0E 0E 0 1E 4E 0E 0E 01ȉEMEEEEUEEEE 4E 0E 0E 0E 4E 0E 0E 01E 4E 0E 0E 0 1E 4E 0E 0E 01ȉEE 4[E 0E 0E 0E 40E 0E 0E 01E 40E 0E 0E 0 1E 4[E 0E 0E 01ȉEMEEEEUEEEE 4E 0E 0E 0E 4E 0E 0E 01E 4E 0E 0E 0 1E 4E 0E 0E 01ȉEE E 0E 0E 0E 4TE 0E 0E 01E 4TE 0E 0E 0 1E E 0E 0E 01ȉEMEEEEUEEEE 4E 0E 0E 0E 4E 0E 0E 01E 4E 0E 0E 0 1E 4E 0E 0E 01ȉEE 4E 0E 0E 0E 4#E 0E 0E 01E 4#E 0E 0E 0 1E 4E 0E 0E 01ȉEMEEEEUEEE EE؉EEMԋE2E2EEMԋE2E2EEMԋE2E2E EMԋE2E2EE EEE}E 4E 0E 4uE 01E 4E 0 1E 4uE 01ȉEE 4gE 0E 4E 01E 4gE 0 1E 4E 01ȉEMEEEEUEEEE 4E 0E 4E 01E 4E 0 1E 4E 01ȉEE 4E 0E 4E 01E 4E 0 1E 4E 01ȉEMEEEEUEEE E 4E 0E 4E 01E 4E 0 1E 4E 01ȉEE 4E 0E 4{E 01E 4E 0 1E 4{E 01ȉEMEEEEUEEEE 4E 0E 4E 01E 4E 0 1E 4E 01ȉEE 4vE 0E 4E 01E 4vE 0 1E 4E 01ȉEMEEEEUEEEE 4E 0E 4JE 01E 4E 0 1E 4JE 01ȉEE 4E 0E 4E 01E 4E 0 1E 4E 01ȉEMEEEEUE EE$E 4E 0E 4E 01E 4E 0 1E 4E 01ȉEE 4xE 0E 4kE 01E 4xE 0 1E 4kE 01ȉEMEEEEUE(EE,E 4E 0E 4EE 01E 4E 0 1E 4EE 01ȉEE 4E 0E 4}E 01E 4E 0 1E 4}E 01ȉEMEEEEUE0EE4E 4E 0E 4E 01E 4E 0 1E 4E 01ȉEE 48E 0E 4KE 01E 48E 0 1E 4KE 01ȉEMEEEEUE8EE<E 4 E 0E 4E 01E 4 E 0 1E 4E 01ȉEE 4E 0E 42E 01E 4E 0 1E 42E 01ȉEMEEEEUE@EEDE 45E 0E 4E 01E 45E 0 1E 4E 01ȉEE 4E 0E 4E 01E 4E 0 1E 4E 01ȉEMEEEEUEHEELE 4E 0E 47E 01E 4E 0 1E 47E 01ȉEE 4E 0E 4qE 01E 4E 0 1E 4qE 01ȉEMEEEEUEPEETE 4E 0E 4E 01E 4E 0 1E 4E 01ȉEE 4lE 0E 4E 01E 4lE 0 1E 4E 01ȉEMEEEEUEXEE\E 4CE 0E 40E 01E 4CE 0 1E 40E 01ȉEE 4uE 0E 4E 01E 4uE 0 1E 4E 01ȉEMEEEEUE`EEdE 47E 0E 4E 01E 47E 0 1E 4E 01ȉEE 4&E 0E 4E 01E 4&E 0 1E 4E 01ȉEMEEEEUEhEElE 4E 0E 4E 01E 4E 0 1E 4E 01ȉEE 4E 0E 4E 01E 4E 0 1E 4E 01ȉEMEEEEUEpEEtE 4E 0E 4E 01E 4E 0 1E 4E 01ȉEE 4HE 0E 4?E 01E 4HE 0 1E 4?E 01ȉEMEEEEUExEE|E 4E 0E 4^E 01E 4E 0 1E 4^E 01ȉEE 4E 0E 4E 01E 4E 0 1E 4E 01ȉEMEEEEUEEEE 4E 0E 4E 01E 4E 0 1E 4E 01ȉEE 40E 0E 4[E 01E 40E 0 1E 4[E 01ȉEMEEEEUEEEE 4E 0E 4E 01E 4E 0 1E 4E 01ȉEE 4TE 0E E 01E 4TE 0 1E E 01ȉEMEEEEUEEEE 4E 0E 4E 01E 4E 0 1E 4E 01ȉEE 4#E 0E 4E 01E 4#E 0 1E 4E 01ȉEMEEEEUEEEEEȃD[]US$EEED$E D$E$蛓E$/E$[]U EЋE1‹E1‹E1Љ‹E1ЉEEЋE1‹E1‹E1Љ‹E1ЉEEЋE 1‹E 1‹E 1Љ‹E1ЉEE ЋE 1‹E1‹E1Љ‹E 1ЉEUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEE$EEE E1EME3EEUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEE,EEE(E1EME3EEUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEE4EEE0E1EME3EEUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEE<EEE8E1EME3EEUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEEDEEE@E1EME3EEUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEELEEEHE1EME3EEUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEETEEEPE1EME3EEUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEE\EEEXE1EME3EEUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEEdEEE`E1EME3EEUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEElEEEhE1EME3EEUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEEtEEEpE1EME3EEUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEE|EEExE1EME3EEUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEEEEEE1EME3EEUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEEEEEE1EME3EEUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEEEEEE1EME3EEUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEEEEEE1EME3EEE1EE‹E U EU EU EE1EU EU EU EU EE1EU EU EU EU EE1EU EU EU EU EUS$EEED$E D$E$$$$[]U EЋE1‹E1‹E1Љ‹E1ЉEEЋE1‹E1‹E1Љ‹E1ЉEEЋE 1‹E 1‹E 1Љ‹E1ЉEE ЋE 1‹E1‹E1Љ‹E1ЉEUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEEEEE1EMMEE1EUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEEEEE1EMMEE1EUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEEEEE1EMMEE1EUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEEEEE1EMMEE1EUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEEEE|E1EMMExE1EUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEEEEtE1EMMEpE1EUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEEEElE1EMMEhE1EUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEEEEdE1EMME`E1EUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEEEE\E1EMMEXE1EUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEEEETE1EMMEPE1EUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEEEELE1EMMEHE1EUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEEEEDE1EMME@E1EUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEEEE<E1EMME8E1EUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEEEE4E1EMME0E1EUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEEEE,E1EMME(E1EUE EЋE1EЋE1EE 1ȉEUEEЋE1EЋE 1EE1ȉEEEEEE$E1EMME E1EE1EE‹E U EU EU EE1EU EU EU EU EE1EU EU EU EU EE 1EU EU EU EU EUS$EEED$E D$E$$$$[]USD$0D$\$t@D$LD$\$oD$D$L$tH)LD$LD$\$D$@D$L$t4HD$ D$\$ D$LD$\$D$D$L$tXH^LD$LD$\$DD$ D$L$t|H DžHH[]ug{vȚJӀxkE}8K 25ؘ7qlC0u7&H?^к0[T߼#m[=Y]҂c.ٵQ,|sLT t6aQ8:Zs,`%b lNBkS|j('敽E$F;fpʕV׸à wúwo93@b+qyy $A:عŚMD~چzf=pҳA {r1'S> 3`&_\v*IR!_ē ّŅ9I-O1;G#mFN>-idH*Oe/x\Xz՘WKgZd(c?)id*/zKZ(?)3&_v*I!9ͭ1#N-HOex\XWgdcB3||&_==סv*Ia!s?ٵmmŮxx9mřͤvv>>1gˋG[#``ݰjjMMN-|UUHZ~~O!!ze&^^xfZZ\KeeXNbbE@@W33g^d}OOjc/ttu \\t<3--00I..IIhrFFDUwwبMC((i))y.JY BBnG//49##5bj녅"ɡqq𐐛SዋNNo>oo TRۻ{/ii99 a#PDllF''%vІPPVU Q%zz99٩gqRRevEEKKࠀZZfxjjcc**68T Cb5$AAwl((C2u{{7& pDD~~ZHzжG$$<0祄kkAT``#E::[h=Y!ff1oo>WWc[M.mmكQS]]c|hh;?00֥zz%  5㧧#a鯌:\\ s11',v%VV {Nk44SjÙ[[GGk""ȽEnⳳtt/fXXV +^^,,µIIϕ~}} d wm9j||3qqb7q=yQ >>ܭ??-$vvUU@@xx%%͹MwwUD PP077ӡ@aa4NNTTlpss*;;Rҟ A{؈Og1''Fgg'88( HHx`.LLeeK\++DZoBB RJJ==_Y :Ia|-!!OBrr;//GH,mF<)iOO}d*..Iii/\^zчddե&&K`Z66"(uu?y)--3B|3|&=_=סv䔁*Ias!ė?mmxxm9vv>>g1G[`#`jjMMN|-ޝUUZ~H~!O!z&e^^fZxZKe\eNbXbE@@3W3g^}OdOjc/ttu \\t3-<-00I..IIrFhFUwDwبM(C()iy)ّ.ѬJYּ֨ BBn/G/9#4#b5j܅"qqSԋNNo>ooT R{i/i99 #aôDlPlF''v%PPVUQ %zz٩9ِgqqReevEKfxZfݰjc68*6T TC Cb5b$$wlAwC(2u27{ԛ&p pDZH~ZzzЌGG<0$o>Wc[[MM.mQSSc|]c;h;??֥0%z% 55#a#鯀:\s ',1'v%v V{{NkS4jęÙ[GkkȽ"Enn/t/f̙XVԋ ++^µ,‰I~~ } ddw m9mjj3|ѡqb7q7=y=Q Qܭ>-$?-vU؂@x͹%MUDwU  P00ӡ7@@4a4NlpTl*s*R;R A {؈OOg1gF'F'g( 8(x`Hx..LK\eKDZ+oo B RJ_=YY ::Iaa|-|O!BB;r۸G/HH,m,FW)i)}dO}*I.I/i\\^^zЇчdK&``Z"(6"?uy)y3<-3_Ly_ʖX5XĜCUMY8}8W3itSittėVVr~JJ"NXbN_94#9nDPlD]2]rhFr&e&͓Ȟւ+nP@pP܅u u2ߍL)Ls!s ]Qo6BJ^.Sj/4TE\k0K5UF $]l1+Ls6͂VbGO%^'fm֜y2h,Z)"M`{;t7oWcܬH PBx&e_(!Ygnz: Aî3Di-R J[*#Nar=|<}u>8?vp~X dw@9I QCqȡ @My>|7n 0`[!BEY)R (P 4hc{|7n 0`[!BEY)R (P 4hc{rBB$p   !-9N_4lqz4lI}lQ{C{HC  0!@   1 H^n,@,twofish.cq0q1mdspoly_to_expexp_to_polycalc_sb_tblselftest_failed.5649initialized.5648do_twofish_setkeyselftesttwofish_setkeydo_twofish_encrypttwofish_encryptdo_twofish_decrypttwofish_decryptciphertext_256.12580key_256.12579plaintext_256.12578ciphertext.12577key.12576plaintext.12575__i686.get_pc_thunk.bx_GLOBAL_OFFSET_TABLE__gcry_log_error_gcry_burn_stackmemcmp_gcry_cipher_spec_twofish_gcry_cipher_spec_twofish128  !n x     "     " I [ o         3 G Y k        - ? Q e        ' ; M t         , S g {        = Q c u       # 7 I [ o       $ 6 H Z         0 D k         * Q e w        7 K _ s        * > P d        ( : N u          4 [ o          F T b p }            / = K Y f         4 L b x        - B X n           6 K        ( @ V l         ! 6 L b x        * ?         4 J ` u        * @ V l         3 {        ( > T i          4 J ` u        ' o         2 H ] u        ( > T i         c y        & < Q i       ! ! 2! H! ]! u! ! ! ! ! ! ! " W" m" " " " " " " # # 0# E# ]# s# # # # # # # $ &$ <$ Q$ i$ $ $ $ $ $ $ % K% a% w% % % % % % % & $& 9& Q& g& }& & & & & & ' ' 0' E' ]' s' ' ' ' ' ' ' ?( U( k( }( ( ( ( ( ( ) ) -) E) [) q) ) ) ) ) ) ) * $* 9* Q* g* }* * * * * * 3+ I+ _+ q+ + + + + + +  , !, 9, O, e, z, , , , , , - - -- E- [- q- - - - - - '. =. S. e. {. . . . . . / / -/ C/ Y/ n/ / / / / / /  0 !0 90 O0 e0 z0 0 0 0 0 1 11 G1 Y1 o1 1 1 1 1 1 1  2 !2 72 M2 b2 }2 2 2 2 2 2 3 3 -3 C3 Y3 n3 3 3 3 3 4 %4 ;4 M4 c4 y4 4 4 4 4 4 4 5 +5 A5 V5 q5 5 5 5 5 5 5  6 !6 76 M6 b6 z6 6 6 6 7 7 /7 A7 W7 m7 7 7 7 7 7 7  8 8 58 J8 e8 {8 8 8 8 8 8 8 9 +9 A9 V9 n9 9 9 9 9  : #: 5: K: a: w: : : : : : : ; ); >; Y; o; ; ; ; ; ; ;  < < 5< J< b< x< < < < = = )= ?= U= k= = = = = = = > > 2> M> c> y> > > > > > > ? )? >? V? l? ? ? ? ?  @ @ 3@ I@ _@ t@ @ @ @ @ @ @ A &A AA WA mA A A A A A A B B 2B JB `B vB B B B B C 'C =C SC hC C C C C C C D D 5D KD aD vD D D D D D D E &E >E TE jE E E E E F F 1F GF \F tF F F F F F F G 'G =G SG hG ~G G G G G G H H .H DH ZH oH H H H H  I !I 7I LI dI zI I I I I I I J /J EJ ZJ pJ J J J J J J  K "K 8K NK cK K K K K K  L #L 1L >L VL dL qL L L L L L M ,M AM \M qM M M M M M M >N PN fN {N N N N N N O O 0O HO ]O uO O O O O P 'P jm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-CRC32CRC32RFC1510CRC24RFC2440Wnn(s GCC: (GNU) 4.2.2 $.symtab.strtab.shstrtab.rel.text.data.bss.rodata.rel.data.rel.local.comment.text.__i686.get_pc_thunk.cx.note.GNU-stack.group4 <G @  % +0 < 8 X x LhUzr~~`   0W W+n67BYN`(Kss ;    (@((crc.ccrc32_tableupdate_crc32crc32_initcrc32_writecrc32_readcrc32_finalcrc32rfc1510_initcrc32rfc1510_finalcrc24rfc2440_initcrc24rfc2440_writecrc24rfc2440_final__i686.get_pc_thunk.cx_GLOBAL_OFFSET_TABLE__gcry_digest_spec_crc32_gcry_digest_spec_crc32_rfc1510_gcry_digest_spec_crc24_rfc2440 7  @TX\`md.o/ 1249659006 0 0 100644 17600 ` ELF&4(  UVS0EEt2ED trEDu uTELE4EDD$L$ t$D$ $EE}uEP}t D$D$$0[^]US$EEE EEED$$$[]US4EEE EE@ EE}tIE*EED$E$uEEEEt}tE4[]US$ D$ED$$EE$[]US$ CD$ED$$EE$[]US4Et$<E$} tE E EED$ED$ ED$D$ $E$}uUEEPEE$UEE4[]UED$$U} tEE MEEUED$$ UE D$E$US$E$$[]US$E}tFD$D$E$t!D$D$E$uEE$E}E@EE`EP ED$E$u7} t E@‹E }tEP EEEEEP Et}tE$E$[]US$E}u E$uǃ$$D$ED$E$YE}u(E$GE}tE@EE$$EEE$[]US$E$uǃ$$E D$$E}tE@EE$$E$[]US$E$E@$UD$D$$EPE$ҋE@E}uE@t%E@‹E@T$D$E$J$[]US$}E@ t E$ E@EiE܋@E$E܋@$$E܉EE܋@ EEEm}uE܉$EE܃}uE@t>E@EE@EEEm}uE@$EEE@EEEm}uE$$[]UE$UVS E@ E@tQEP E@M T$ D$D$ $t D$D$$}tKE@ D$ D$ED$E $t D$D$$E@E[E@t'EpE@U MD$T$ $֋EHUED$E D$$ыE@E}uE@ [^]UED$E D$E$US4E@lE@tD$D$E$JE@EEPE$ҋE@E}uދE@E@E$EED$E$EE$,EE@D$ D$ED$E$E}tED$$E@EPE@UL$D$$\UED$ED$$CE$UED$$=‹ED$T$E$E$4[]US4E$EE}u EE@;EE$$E}u$E<ED$ E D$ED$E$EE E$EE@;Es*D$ D$cD$$E@‹E@T$D$$E@EEPE@EED$E D$E$ED$E D$E$E.EUEE46EUEE4\EE@;EŋE$EE؃4[]US$EE E}t}}tb} t;}!tITE$^NED$ED$E$$>E(ED$E$E$xE=E$ $[]UE$UE]U(EE@u EF-U ED$T$E$:E}u E$E$U} tE D$E$  E$US$E@E} u6}tE@t$EP E$҉EdE@E1E@PE 9uEP E$҉E/E@E}uɍD$D$$E$[]UD$ D$D$E$E D$E$US(D$D$ D$D$$?[]UVS }uED$ED$E $}u'uED$ED$E $}u%tO$tD$ D$ED$E$TE}t,E$K$D$ED$H$UED$ED$$E$E$ƋUED$$t$D$E $E$ [^]US4E@E}tJE@t@xD$D$ lD$D$$$}tE@@EEE4[]UE$^US$E$uǃ$$E D$$E}tE@@EE$$E$[]UE$GUS$E$uǃ$$E D$$E}tY} tE@@‹E }tE@@‹EE@@EE$$EEED$$E$[]US$EE E}t } t0}u}t E-E$oEE$\E}D$ED$E$E}t/EE9r#ED$ED$E$UE5}u}t UE}t EBE-E=E$m$[]UVS`E@ t${E D$T$ D$D$1EƉ$E0D$EƉ$F E@ uEƉD$$`[^]UWVSLE@ tAE@tD$D$E$E@ $E@ EEE*EEƿEUEUċMϋU։UM̋EEUMMEUE؉U܃L[^_]UEE E} t}#tzE@‹Ep}t}tEt E-QEEEE@E$E@PE9u EE@E}uE=E$:USE$uǃ$E[]U(ED$ D$D$ E$tEEU(EED$ E D$D$#E$tEEUS$E$ E D$ED$$E$E$[]US4EEE$uwǃ$$E D$$E}tE@u E@ E$}t)Et EED$E D$E$҉EqE}td}t E@t"}t ,E ?EEE SEED$ iD$ED$p$EЃ}t'$E$$E$A4[]./0-   1md_register_defaultmd.coid.OID.?md_enable: algorithm %d not available MD5 usedmd_copyahd->bufsize == (n - sizeof (struct gcry_md_handle) + 1)! ahd->bufposunknownmd_writeprepare_macpadskeylen <= hd->ctx->macpads_Bsizemd_readmore than one algorithm in md_read(0) _gcry_md_getunimplemented function calledgcry_md_open failed for algo %d: %smd_get_algopossible usage errorWARNING: more than one algorithm in md_get_algo() no ASN.1 OID for md algo %d Oops: md debug already started dbgmd-%05d.%.10swmd debug: can't open %s algorithm disabledalgorithm not foundno selftest availablemoduledigestGCC: (GNU) 4.2.2$.symtab.strtab.shstrtab.rel.text.data.bss.rel.data.rel.rodata.comment.text.__i686.get_pc_thunk.bx.note.GNU-stack.group|4 E<! 9 % "+ "4 " 0 C >#wFw%O%l%%h(@3 0n$<Nb u@C== S%.n#9KHS1\ fXx N I5L_ #5 Gl Yd   m !=Vt1M dzC?/DL^uc@ u) "9MTe7s(!CNh\-=O 8Oh|" lWr8(><]J\E md.cdigest_tabledummy_extra_specdigests_registered_lock__FUNCTION__.5800md_register_defaultdigests_registeredgcry_md_lookup_func_namegcry_md_lookup_func_oidgcry_md_lookup_namegcry_md_lookup_oidgpg_errorgcry_errorgpg_err_makegcry_err_makesearch_oiddefault_digests_registereddigest_algo_to_stringcheck_digest_algomd_openmd_closemd_enable__FUNCTION__.6203md_copymd_writemd_start_debugmd_stop_debug__FUNCTION__.6382md_finalmd_get_algomd_readmd_digest_length__FUNCTION__.6489prepare_macpadsgcry_err_codegpg_err_code__FUNCTION__.6601__FUNCTION__.6639__FUNCTION__.6682md_asn_oididx.6803_gcry_digest_spec_crc32_gcry_digest_spec_crc32_rfc1510_gcry_digest_spec_crc24_rfc2440_gcry_digest_spec_md4_gcry_digest_spec_md5_gcry_digest_spec_rmd160_gcry_digest_spec_sha1_gcry_digest_extraspec_sha1_gcry_digest_spec_sha256_gcry_digest_extraspec_sha256_gcry_digest_spec_sha224_gcry_digest_extraspec_sha224_gcry_digest_spec_sha512_gcry_digest_extraspec_sha512_gcry_digest_spec_sha384_gcry_digest_extraspec_sha384_gcry_digest_spec_tiger_gcry_digest_spec_whirlpool__i686.get_pc_thunk.bx_GLOBAL_OFFSET_TABLE__gcry_fips_mode_gcry_enforced_fips_mode_gcry_module_add_gcry_bugstrcasecmp_gcry_module_lookup_gcry_md_register_gcry_ath_mutex_lock_gcry_ath_mutex_unlock_gcry_md_unregister_gcry_module_releasestrncmp_gcry_md_map_name_gcry_module_lookup_id_gcry_md_algo_name_gcry_malloc_secure_gcry_malloc__errno_locationgpg_err_code_from_errnomemset_gcry_fast_random_poll_gcry_md_open_gcry_log_debug_gcry_inactivate_fips_mode_gcry_md_enable_gcry_assert_failedmemcpy_gcry_module_use_gcry_md_copy_gcry_md_reset_gcry_free_gcry_md_closefwrite_gcry_md_write_gcry_fatal_error_gcry_md_hash_buffer_gcry_md_ctl_gcry_md_setkey_gcry_md_debug_gcry_md_read_gcry_md_get_gcry_fips_signal_error_gcry_sha1_hash_buffer_gcry_rmd160_hash_buffer_gcry_fips_noreturngpg_strerror_gcry_log_bug_gcry_log_error_gcry_md_get_algo_gcry_md_get_algo_dlen_gcry_md_algo_infosnprintffopenfclose_gcry_md_info_gcry_md_init_gcry_md_is_secure_gcry_md_is_enabled_gcry_md_list_gcry_module_list_gcry_md_selftest E F'G4 H YHf v   I  J E F1KKEQ FKE F  LE F   3LKEQ F]G{ N  I OE F NQ OE F R RsKQE F N! 0 : BOH PNQ OE F N   O  N )THQN VOkEq F E F N   O N T$Q3 ;OPEV FVWXY&ZVXY[ E F  N    O " N+ 7 T@ H O[ c ] G ^ H V W X YT \ Ng Qm u O E F V* W8 XB Y{ ` ` a1 VH XR Y a V W X Ya9 ANObU ]O E F9ZE F NQ O5eeeE F/g: L TJg  JQEW FJiaE F6VDXNYvj   `Z#a<aeE FldE F& .]  JkE F  , 4pLER FqqGrG ^Hs t %u{aE F   p v=EC FP XN^ m w O N TQ OE F  N ( 2 :O@ HNQ ]TQ O uE FaE FG "]* 3 9 J azl {{ ]E F|#E) F6 >ND S ] eO}}E F  N ' 0 8 OM ES Fn v N|    O  N  T  OH! S! d! t! ! ! !N!Q! !O34 5$064@7DP8T`9d:p;t<=>?@ABCDcast5.o/ 1249659006 0 0 100644 22612 ` ELFLH4(  US4EEE@EEE ‹E ‹E ЉEEE ‹E ‹E ЉEEEEEEEEEЋED$$TEEE%1‹E%)E 3EEEEEEE3EEEЋED$$EEE%)‹E%E 13EEEEEEE+EEEЋED$$SEEE%‹E%1E )3EEEEEEE EEEЋED$$EEE%1‹E%)E 3EEEEEEE3EEEЋED$$NEEE%)‹E%E 13EEEEEEE+EEEЋED$$EEE%‹E%1E )3EEEEEEEEEEЋED$$JEEE%1‹E%)E 3EEEEEEE3EEEЋED$$EEE%)‹E%E 13EEEEEEE +EEEЋED$$IEEE%‹E%1E )3EEEEEEE$EEE ЋED$$EEE%1‹E%)E 3EEEEEEE(3EEE ЋED$$DEEE%)‹E%E 13EEEEEEE,+EEE ЋED$$EEE%‹E%1E )3EEEEEEE0EEE ЋED$$@EEE%1‹E%)E 3EEEEEEE43EEE ЋED$$EEE%)‹E%E 13EEEEEEE8+EEEЋED$$?EEE%‹E%1E )3EEEEEEE<EEEЋED$$EEE%1‹E%)E 3EEE‹E U EU EU EU EU EU EU E4[]UE ME E ]US$EEED$E D$E$$$$[]US(EEE@EEE ‹E ‹E ЉEEE ‹E ‹E ЉEEEEEE<EEEЋED$$EEE%1‹E%)E 3EEEEEEE8+EEEЋED$$NEEE%‹E%1E )3EEEEEEE43EEE ЋED$$EEE%)‹E%E 13EEEEEEE0EEE ЋED$$JEEE%1‹E%)E 3EEEEEEE,+EEE ЋED$$EEE%‹E%1E )3EEEEEEE(3EEE ЋED$$EEEE%)‹E%E 13EEEEEEE$EEE ЋED$$EEE%1‹E%)E 3EEEEEEE +EEEЋED$$DEEE%‹E%1E )3EEEEEEE3EEEЋED$$EEE%)‹E%E 13EEEEEEEEEEЋED$$@EEE%1‹E%)E 3EEEEEEE+EEEЋED$$EEE%‹E%1E )3EEEEEEE3EEEЋED$$;EEE%)‹E%E 13EEEEEEE EEEЋED$$EEE%1‹E%)E 3EEEEEEE+EEEЋED$$:EEE%‹E%1E )3EEEEEEE3EEEЋED$$EEE%)‹E%E 13EEEEEEEEEEЋED$$5&5 M{n0f&%HVV^c ϲc|E pPr(pH# yM;-AB G&LjMG\^ |Y#јr8S#/nqFnEV 9q +A|iCHy}B{BIZݿe\ [ ~iC?9zaz UQry吝5rNcZպ60ę _}֡{/6Y DYD̃Aѱ* ;{ B[A%zzӤ0XޘN?wiy{$[Ĭ%5P_aT1bcKU !h]Yfsc=4·~!+g\ab906;Wd/`:5F- 'zy㠌l0^7%oo;j tE'4:NiOM>dY58EfCr3c%N? (Υ'R¦սTUdpfM w&ۄgC!`X0TroSUGڿ]bVhkʃ;n-Ӧ\= wL3{9+^S_aodC x^c"&gI{ڷ"%-U^7rRyL H[k0 cq/޹ S E!5(T<)c)A|-nRPf4,0P1`sY&D\dwR3A+ٺ|o!PaH?ek«dv&4{^% ;MM1$~I,;jx`]sVz\/1Co0TyXR^/2zj0>՚1B°I #ڸ(0q_`ɣaM/Ǚ."płNؼ40y;'ƸaiH?;(ZC/v7ܱӧßn>ƼB7Q(heRwj-K'5.n\ )^XOX{iT̨g&H`K`8# ~8lI `s5GƱVL>#8d^BFzk Od^AE#\;]>rC|m~ll9`qpsv#E@]%=`GK6DήPQH<p}}d^(O= &g.yr?U+HԼ?^!@WNFRWs3NɷdŸW1O g_?@k{C=K۵cUȗn-J(JqoCCl< _P/~׿PZG.Q>pX.0_|r *,]I鎸P'WIoyR}}Yr@EEt]>uOiVA#. '`vteyvvwHNma}/ 4H<0(Ow Vܒ M"7)}V'|@|硴f^aÝ <є`AFv\;x,WGl"}NC~8<=Q8d{h'فI]j~vh]9K9 ;#Im<Eub'z\aBΒ~Brrp }ȡ[(Ob<51)BSjO[}m(Ki\j#MŌ?,-ҖXRg[HJI \EkӉ7`:SRqDIK @sg4|~q6UO/Т`?mPьGnU?墼38Wg} =3{r3O̫]ňv{{uWBdBc+ri/n+_mazgaq%9̸L!gуb>ܷν8\ =Dmn`I:T`H'W+8$ ږ%Eh;}E `P/(b4 ٠m+1+dZ0RXBA\1>26F3S75 {s{OJWdCQz(~c5_ yCdcdJ$_(͸O@C " 0 O7-{$MgQLq_-_d !S^>'_aB%rqK=;&o~~TLmDl߫I&Ǡ36~?Pa w8Pr.PwWFgOT3ɏ1 i5M\=fȦ[]oڑo/"F}F9mOCCN!и  ?X(>nH&p׋wt|% - y#;(8itb߷@!{7Ȋ@ YVvO@/{U MVi35'#WȯVeka^u˅nwU2?-ɿ[%;з$;mc fÀ(82 Tɪס2Zb,gTzuw11&o6F HjyZVLj~CRv/ t,t* M|k .TA5B=!&|,aRe1i%& !\1cr ^Iy p1 d>>̶Ոî 0rlqn/kءDVÈ9/ű1(x⤣2}o~X$Ū{s0a!-!)۳*)e\,0?Б\,ԩT _w:^VxV޾\!uQųåҶw#)Ei/z毲p[v F98/gsD)k)/Ifingӛ/~p%Q^$Slj>!DYܷ)eyCy9A+MWN )zkS< ~U3rŅ?~  ~tn,fy3jXDD1Zs"*ˁc8:$zi HIĀ@8HުL H_%A@N$A UeQr% 9jyMc@hV 틕Z Vqק)N-fcqw*7 5Wa"ɠBր[t!h!hl iwW~@PճMװx QV$AV ʔUWnྵa$ XK'aU{whkldMDfd~i/IO70j5,s@IvM;B(HDLns) _ɋ}oaOw.+rץ<}+FYYEEهTNoHm| ǥcs_DVj͈prͳ]ny` E`1©\1BN"r\,rN@%/N2g@#x\n܃"ukMxnXO DH?{vw#Vu*F_( +8=6 JRft;QZylu eX&hJpFS(l\v0k)h76*g$ k%ֿh,DUueI40" WIbuU~bڨv^FESGml,gHL|3ەCh\SU2` ߝWc9^28aI37~^b<#NygCHKJf-ۄoH Ja)Yfc(` 0qt&@3/C~A^ l( ؒ0~of˜os*`ژ46K-%#= %IH6Jo8C@TzWOpA:Z„TU|5YŗZ:G:%Sj~=eI&TwQ[P]vlDȨ!帊iX`[ŗY)L;]J5ULkD$5鰽bעT/I18T(q)9H[/u@g+3-fVo*ɛ`( ')dMP˲,\26K_A !PNhذy\CPIMAC8wn\e0Rԋ@+>`xT7}02m-yyS"wuXȃoxkcZ\3]ùzv٣Byqj3ƚ`'PC=+mvN%ύHf6AN( aϩI=߹_d: }+p?PO+Zbbyj.H@,Z@"ғ-ES4n)olIIBr~V>olbfLTq*+9)XLVRf.S9v.i硦>iFt+LVvuOx39]O#2]2=&K/~~<O^?vf)o=E4ӷ+4grN=U"g`k8=ü0}8QcÐӝXyTGָaYwSW-XVcNx.F~eyUڑ0@5㶼P?!@=LXI6QpӱڍyKoqK 0ݻ맕d5w$,ϩ/ tцB*v:-7ޚ, )p@ :$7ѴyN] h1 HZ޻Bf1畏?r 3uQB}\cmd!@ WS1zݨ]3CoFq"8ԚέiGb[UgfN G[oLĎnrWxzdD]Ջ` l_9 ]c2֋~ pIPӻߘ)* mS~H~X.t;/RG'~[!<8zvOB9`55'{ɸ6g {pqT3^-ZId, =4pBwbO&Ҹ$d%FN`7>͕xE_{ ۫v"{.1ן%$r_m L=mPO%os#(ĴyI%4aĘnzn|l6AT޾'VAJJ{` ,8I%vK$%Gv XY f 0NndQ& #Phꃢ12CAST5 selftest failed (%s). CAST5! P&< GCC: (GNU) 4.2.2$.symtab.strtab.shstrtab.rel.text.data.bss.rodata.rel.data.rel.local.comment.text.__i686.get_pc_thunk.bx.note.GNU-stack.group4 <& $N %,'+,'0@'' <G, 8 4X LGUGrGGJP L.   !) 2) 6< CD ) UCcRl&Ix=8$m    ,cast5.cs1s2s3s4s5s6s7s8do_encrypt_blockrolencrypt_blockdo_decrypt_blockdecrypt_blockselftestcast_setkeykey_scheduleselftest_failed.7331initialized.7330do_cast_setkey__i686.get_pc_thunk.bx_GLOBAL_OFFSET_TABLE__gcry_burn_stackmemcmp_gcry_log_errormemset_gcry_cipher_spec_cast5     b t       f x        g y       l ~       p       $ q       ( v       ) z    D J u   f x       k }       l ~      # p       $ u       ( v         - z       ! .         ,    ! ! BH d z       - F l       ( A W r        8 Q r        , E h ~       + A g          9 L g {       ' @ ^ u        ! 7 W m          9 _ x       4 J e y       % > \ s       " ; ^ t      ! !! 7! ]! v! ! ! ! ! " " /" B" c" z" " " " " "  # ## 9# Z# q# # # # # # # $ -$ C$I$ O$ Y$ h$ n$ x$ $ $"$ X&#s&#&#&& &  hmac-tests.o/ 1249659006 0 0 100644 9584 ` ELF84(  US$E$;E tED$ED$E$tEUED$ED$$tE$'EUED$E D$$UED$$E}uE$=EEE D$ED$E$tE$QEE$EE$[]US`EEEUlE}?~D$oD$D$@lD$ D$ D$$VE}}EEE0EUlEE}~D$D$D$lD$ D$ D$$E}EEEPEUlEE}c~D$D$D$dlD$ D$ D$$FE}EEEpEUlEE}0~D$D$D$1lD$ D$ D$$E}u Džh4} t$ED$ ED$D$$E Džh2hĴ[]UWVS<EUEUЍp UD$NjUDE؋UD$E܋UDD$t$|$U؉T$ U܉T$D$$ mE}u2}t#EUE1} t$ED$ ED$D$ $E E2E<[^_]UWVSLEfU荋 )EU) p U荋 )D$NjU荋 )DEȋU荋 )D$E̋U荋 )DD$ t$|$UȉT$ ỦT$D$$E}U荋 )D$ƋU荋 )Dt$$E}uE&U荋 )D$ƋU荋 )Dt$D$E$E܉D$E$E}uEE$E܃ u;U)  D$ D$E$tEE$BE$}t(EU荋 )vE1} t$ED$ ED$D$$E E2EЃL[^_]UWVS<EE`)ЋEE)Ѝ`Ѝp E`)ЋD$NjE`)ЋDE؋E`)ЋD$E܋E`)ЋDD$0t$|$U؉T$ U܉T$D$$ E}u3}t$EE`)ЋE1} t$ED$ ED$D$ $E E2E<[^_]UWVS<EU )EU) p U )D$NjU )DE؋U )D$E܋U )DD$@t$|$U؉T$ U܉T$D$$ kE}u9}t*EU )E1} t$ED$ ED$D$ $E E2E<[^_]US$} EED$E $EcED$E $+ELED$E $E5ED$E $aEED$E $EEE$[]US$ED$ D$D$E$uED$E D$E$E6E}t)8D$ PD$ED$$EЋE$$[]UED$$U} tEE MEEinvalid tests datagcry_md_open failedgcry_md_setkey failedgcry_md_read faileddoes not matchFIPS-198a, A.1OL֋ ]@< Sample #1FIPS-198a, A.2 "@_=OX0s}\]$Sample #2FIPS-198a, A.3\|ѣSample #3FIPS-198a, A.4hB u$2u*&Sample #4hmacdata-28 key-4what do ya want for nothing?Jefedata-9 key-20Hi There data-50 key-20data-50 key-26 data-54 key-131Test Using Larger Than Block-Size Key - Hash Key Firstdata-152 key-131This is a test using a larger than block-size key and a larger than block-size data. The key needs to be hashed before being used by the HMAC algorithm._gcry_hmac256_new failed_gcry_hmac256_finalize faileddoes not match in second implementationalgorithm not availablemodule+H ۿEi:~maH^DM[doh2|ԝ?GOShK"y5iM}jde]i3lPht6FMБ)Y >"cUeU8D<́:xz.?g)f[-@x`1Y & !7(FTx /'c_հDcdOQS\:5+HEvH@1axҵk~dG.sc"D^"@^iNj29IM[d9DHbk%FƂL|ŜꞩnJRy&歊 Ȩo 5G>YfK*Z8N:O'>ix<%3blzHPW|nW;Nh#ħyt-@xND>:ŴO*+X<: .@0$cIRxf 5/%N,`$ λFŦx1m8` FR>+HKz{;Vࣇd".' %TXuZJmOe걣MJkKcn 87M[d|ޥaO$l#yNxzгE|ڨ3ָ'N依Nap.il :hTysVul 鱵ݎ6U>3'9>y"~gF7&t'Y2FV7EiJvK-oP6۩^y'\xcA O--@xBc{贛FJ7RkV7_%!]jROs? 싑Z]xex{jw]}ߩn^?޽qr]- D,E E$$E$E(E,$E,EEȋEȃd[]US$E@ @$EEEHE@T$ L$D$E$E@ D$E$EE$E$[]US$E@$EEEHT$ ED$L$E$E@D$ED$E$E@$EE@D$ED$E$E@$EEPED$T$E$ED$ED$E$E@D$ ED$ED$E $E$E$E$$[]USDD$E$~E@D$E$x ED$E $~E@D$E $x EjE@@$EE@@$EE@@$EE@$EE@D$E D$E$E@D$ ED$ED$E$E@D$ ED$ED$E$E@E܋EEЋE@ EEEEEED$ EЉD$E܉D$E$E@D$ED$E$ED$E$EE$E$E$E$EEȋEȃD[]UVSEEEEEED$ D$E$}=D$D$E$E}ED$D$E$E܃}tE0vE$DžDAED$E܉D$R$EƄRD$D$R$EċE$D$D$E$E}tEE$D$D$E$ED$ D$E$E}tEE$D$ D$E$E}tEE$D$! D$E$E؃}}u }u} t%E؉$Eȉ$DžD7D$( D$E؉$ED$D$E$EE$D$* D$E؉$ED$D$E$EE$D$, D$E؉$ED$D$E$EE$E؉$EtEtEu;E$E$E$Eȉ$DžDE$E E$Eă}u}u}u )ED$$ED$ ED$ED$ED$EЉD$EȉD$ EĉD$E D$E$EEȉ$}EUMEuT$L$D$t$ 0 D$D$E$$ E}tZE$EE$EE$EE$EE$EE$E$1ED$ED$ẺD$ EĉD$E D$E$EE$E$E$}UEUEUEU EUE} EuEuE EEEEEtEEuދE2$E}u ED$Y D$E$EEt#D$h D$E$E}t~D$ k D$E$ EE'D$x D$E$EEE;E|D${ D$E$ED${ D$E$EED$$E}u EEEtEUEEE%EUEEEEE;E|ӋEEED$ ED$D$E $$EE$E$E2EE$EEEE;E|ƋE}t7E(EE$EEE}~ҋE$EDD[^]UE]U(D$ED$ED$D$ D$E D$E$@U(EE t0E t$E tE t E u EJE EE EE EE EE EE$uEEUVS0E}t9Et0Et$EtE t Eu EEEEEEEE EEEE@$‹E u E@$E E ED$ ED$T$ $E0[^]U8EEt?Et3} t-Et$EtEt E u E[EEEEEEE EEEED$ E D$T$ $uEEUSE $[]US4EEEED$ K D$D$E$E}u(D$ K D$D$E$E}t, EUE D$T$E$E}t C EbUMED$T$ $E}t R E5UMED$T$ $EE$8t ` EE$E$E$E4[]UE$US4EE{ ED$ D$D$E$E}u(D$ D$D$E$E}tE$Ep EE$E}tE$EC EEUD$$E}uE$E$EGE$E$}t$ED$ ED$D$ $EE2E؃4[]UEtE$EEE(private-key (dsa (p #00AD7C0025BA1A15F775F3F2D673718391D00456978D347B33D7B49E7F32EDAB 96273899DD8B2BB46CD6ECA263FAF04A28903503D59062A8865D2AE8ADFB5191 CF36FFB562D0E2F5809801A1F675DAE59698A9E01EFE8D7DCFCA084F4C6F5A44 44D499A06FFAEA5E8EF5E01F2FD20A7B7EF3F6968AFBA1FB8D91F1559D52D8777B#) (q #00EB7B5751D25EBBB7BD59D920315FD840E19AEBF9#) (g #1574363387FDFD1DDF38F4FBE135BB20C7EE4772FB94C337AF86EA8E49666503 AE04B6BE81A2F8DD095311E0217ACA698A11E6C5D33CCDAE71498ED35D13991E B02F09AB40BD8F4C5ED8C75DA779D0AE104BC34C960B002377068AB4B5A1F984 3FBA91F537F1B7CAC4D8DD6D89B0D863AF7025D549F9C765D2FC07EE208F8D15#) (y #64B11EF8871BE4AB572AA810D5D3CA11A6CDBC637A8014602C72960DB135BF46 A1816A724C34F87330FC9E187C5D66897A04535CC2AC9164A7150ABFA8179827 6E45831AB811EEE848EBB24D9F5F2883B6E5DDC4C659DEF944DCFD80BF4D0A20 42CAA7DC289F0C5A9D155F02D3D551DB741A81695B74D4C8F477F9C7838EB0FB#) (x #11D54E4ADBD3034160F2CED4B7CD292A4EBF3EC0#)))(public-key (dsa (p #00AD7C0025BA1A15F775F3F2D673718391D00456978D347B33D7B49E7F32EDAB 96273899DD8B2BB46CD6ECA263FAF04A28903503D59062A8865D2AE8ADFB5191 CF36FFB562D0E2F5809801A1F675DAE59698A9E01EFE8D7DCFCA084F4C6F5A44 44D499A06FFAEA5E8EF5E01F2FD20A7B7EF3F6968AFBA1FB8D91F1559D52D8777B#) (q #00EB7B5751D25EBBB7BD59D920315FD840E19AEBF9#) (g #1574363387FDFD1DDF38F4FBE135BB20C7EE4772FB94C337AF86EA8E49666503 AE04B6BE81A2F8DD095311E0217ACA698A11E6C5D33CCDAE71498ED35D13991E B02F09AB40BD8F4C5ED8C75DA779D0AE104BC34C960B002377068AB4B5A1F984 3FBA91F537F1B7CAC4D8DD6D89B0D863AF7025D549F9C765D2FC07EE208F8D15#) (y #64B11EF8871BE4AB572AA810D5D3CA11A6CDBC637A8014602C72960DB135BF46 A1816A724C34F87330FC9E187C5D66897A04535CC2AC9164A7150ABFA8179827 6E45831AB811EEE848EBB24D9F5F2883B6E5DDC4C659DEF944DCFD80BF4D0A20 42CAA7DC289F0C5A9D155F02D3D551DB741A81695B74D4C8F477F9C7838EB0FB#)))pk_dsachoosing a random k generatedsa.c_gcry_mpi_get_nbits ((p)) == nbits_gcry_mpi_get_nbits ((q)) == qbits (transient-key)choosing a random x%sqbits >= 160dsa pdsa qdsa gdsa ydsa xself-test after key generation failedgenerate_fips186_gcry_mpi_get_nbits ((prime_p)) == nbits_gcry_mpi_get_nbits ((prime_q)) == qbits!deriveparmsseeddsa hqbitstransient-keyderive-parmsuse-fips186use-fips186-2domainpqg(seed-values(counter %d)(seed %b)(h %m))(misc-key-info%S(pm1-factors%m)(data (flags pkcs1) (hash sha1 #a0b1c2d3e4f510102030405060708090a1b2c3d4#))(data (flags pkcs1) (hash sha1 #a0b1c2d3e4f500102030405060708090a1b2c3d4#))converting data failedsigning failedverify failedbad signature not detectedconvertkey consistencysignpubkeydsaopenpgp-dsaDSApqgypqgyxrs  W"GCC: (GNU) 4.2.2 $Ë$.symtab.strtab.shstrtab.rel.text.data.bss.rodata.rel.data.rel.local.comment.text.__i686.get_pc_thunk.cx.text.__i686.get_pc_thunk.bx.note.GNU-stack.group4*<,D" > %"+"0# <-l 8 ILL.U^.rb.f.f.1`) 8+7H"TQvW3au#fm f\ y @W% L3 LDQW!e1!Us",     "  .>Icj 0?Sc|+?^q%2MZq <\dsa.csample_secret_keysample_public_keyprogress_cbprogress_cb_dataprogressgen_ktest_keyssignverify__FUNCTION__.5936generate__FUNCTION__.6084generate_fips186check_secret_keydsa_generate_extgpg_err_codedsa_generatedsa_check_secret_keydsa_signdsa_verifydsa_get_nbitssample_data_bad.6673sample_data.6672selftest_sign_1024gcry_err_codeselftests_dsarun_selftestsdsa_names_gcry_register_pk_dsa_progress__i686.get_pc_thunk.cx_GLOBAL_OFFSET_TABLE___i686.get_pc_thunk.bx_gcry_mpi_alloc_secure_gcry_mpi_get_nbits_gcry_get_debug_flag_gcry_log_debug_gcry_free_gcry_random_bytes_securememcpy_gcry_mpi_set_buffer_gcry_mpi_test_bit_gcry_mpi_set_highbit_gcry_mpi_clear_bit_gcry_mpi_cmp_gcry_mpi_cmp_ui_gcry_mpi_new_gcry_mpi_randomize_gcry_mpi_add_ui_gcry_mpi_release_gcry_fips_mode_gcry_mpi_copy_gcry_assert_failed_gcry_mpi_alloc_gcry_generate_elg_prime_gcry_mpi_sub_ui_gcry_mpi_fdiv_q_gcry_mpi_alloc_set_ui_gcry_mpi_powm_gcry_mpi_clear_highbit_gcry_mpi_free_gcry_log_mpidump_gcry_fips_signal_error_gcry_sexp_find_token_gcry_sexp_nth_data_gcry_generate_fips186_2_prime_gcry_sexp_release_gcry_mpi_alloc_like_gcry_mpi_snew_gcry_mpi_fdiv_r_gcry_mpi_invm_gcry_mpi_mul_gcry_mpi_add_gcry_mpi_mulm_gcry_mpi_mulpowmmemsetstrtoul_gcry_sexp_nth_mpi_gcry_sexp_build_gcry_mallocgpg_err_code_from_syserror_gcry_calloc_gcry_sexp_build_array_gcry_sexp_sscan_gcry_pk_sign_gcry_pk_verify_gcry_strerror_gcry_pk_testkey_gcry_pubkey_spec_dsa_gcry_pubkey_extraspec_dsa* +  *,0 +6 @ F c ~, +-./ 0/1 292V3a1456678/*9:/^1j/, +:::;c<===, +>???.' 9 C K@V.a s } @AB?.   @&ACC\DjAyE<F9/    (07 I S [@i-C/223 104EGX9r81HHAF/ I  I ' I4 < II Q I = = = = = % 7 ? Jd ,j + ? ? ? .    @ . ' 1 9 @E W a i @  K L M N( OE C^ Di Ox E < F 9 P /;%G89N8]OF/ I I I I  I I=========)=A=Y=i {  J1=, +A=FR8hH}, +FQARA1SJTmUxHHH, +9898/ACAWAjARUUV9QK8aHlHwHH, +W K:LVN3XN KN  K -KHNV eKN KNN KY*N8 GKeYsN KYNN===N".0.J>N Z=&=8=J=\=n1y====|[\ 3 3 3 .3N ]3q 3]\<^R1]1==N, +AA, +., +  _3 J _Y z `  a  a  N!N!N9!,?! +S! d! {!_! !_!b! !c!b! "N)"N="NH"Nj"  $!(,048@DPTX\`tiger.o/ 1249659006 0 0 100644 14216 ` ELF(14(  UEEEͫ@gE#E@2Tv@ E@@E@\E@XUWVSdEEȋEE̋EPE؉U܋E PEUEPEUMȋűE1ȋU1EUEUUMEUƉ%u1Ƌ}1׋EUEUUM1ɉUMEU1M1щMEUEUEUƉ׉1%E1U1)EU܋EUƉ%UMEUƉ%u1Ƌ}1׋EUEUUM1UMEU1M1щMċEUĉEUċEUƉ׉1%E1U1EUEMȋueщʉEUEUME؋U܉QM EUQMEUQd[^_]U8EPEUE PEUEPEUEHED$T$ L$ED$ED$E$EHED$T$ L$ED$ED$E$EHED$T$ L$ED$ED$E$EHED$T$ L$ED$ED$E$E HED$T$ L$ED$ED$E$OE(HED$T$ L$ED$ED$E$E0HED$T$ L$ED$ED$E$E8HED$T$ L$ED$ED$E$EUMQEUM QEUMQUWVxEHUME80x5򥥥u})׉MQME0xu}E0xE1U1QME0xEPQME0xu}E0xu}E0xЉ҉ƉE1U1u})׉QM E 0xu}E0xE1U1QM(E(0xE PQM0E00xu}E(0xu}E 0xЉ҉ƉE1U1u})׉QM8E80xu}E00xE1U1QE0xE8PMQME0xu}ċE0xuȉ}̋E80xЉ҉ƉE1U1u})׉QME0xuЉ}ԋE0xE1U1QME0xEPQM E 0xu؉}܋E0xu}E0xЉ҉ƉE1U1u؋})׉QM(E(0xu}E 0xE1U1QM0E00xE(PQM8E80xu}E00x5ͫgE#u})׉Qx^_]UWVSD$@E D$E$EPE؉U܋E؋U܉EЉUԋEP @EUEUEȉŰEP@EUEUEUD$ED$ ED$EȉD$EЉ$E$D$ED$ EȉD$EЉD$E$tE$ZD$ ED$ EЉD$ED$Eȉ$AuЋ}ԋE1U1EЉUԋEȋU+EUEȉŰEUEUEUċEЋUԋMQEȋŰMAQ EUċMAQČ[^_]US$E EEEE@X@u:ED$E$B$E@XE@\PEP\}E@X$EHXEETQEPXEm}t E@X?~D$D$E$3}t~3ED$E$E@XE@\PEP\m@E@}?w$$EHXEETQEPXEm}t E@X?~˃$[]US4EED$D$E$vE@\EEEEEEEE@XEE;EsEEEeeE EE@X7=EPXEDEPXEPXEDEPXE@X7~tEPXEDEPXEPXEDEPXE@X?~D$D$E$ED$8D$$E‹EPPE‹EPQE‹EPRE‹EPSE‹EPTE‹EPUE‹EPVE‹EPWED$E$n$EEEP1‹EEEP1‹EEEP1‹EEEP1҉‹EEEP‹EEEP‹EEEP‹EEEP‹EEEP @1‹EEEP @1‹EEEP @1‹EEEP @1҉‹EEEP @‹EEEP @‹EEEP @‹EEEP @‹EEEP@1‹EEEP@1‹EEEP@1‹EEEP@1҉‹EEEP@‹EEEP@‹EEEP@‹EEEP@‹EE4[]UEEE^ |CKB [r:mx)pɡsuÃ*k2dpX>Fq\SiA|ލTL MojZ#/W!aroHKAR&GYyŅOKov}RB6c07'hinŴ=vv}BƜ\dB3$x8}.<4k_ `Tr_lOۤ"YqigEeR `yNH-;SvlS{5mW7zzfPq5JBt j$%/9w*윴s/8Q?V(CXE\=i_׶3Dɱ&<"+; 1TYe@ϣ&N5# +Nuc5՝F@@L:z.j>j?k`(Fn=e*"bG U]*逸 ĆQÄ|mXS(v^,&Ґ˔u*d>߯X#(ѧ0Qo,FN*q|3{>9enmty)3q]8[duH|g{|1=K#lMIXq&8cMGbsFE`U4ΏٔʺHhow0$cdn+}3%(pKBk,m ˁ7=ofCUQǀ1+/ߺ2h\V=Uk_夿κ A2]Ds4Z𖦼l(e$JR.Q ZUםNy%3>[) TsG~A4$)mS}598`}Ggvݪ닓bzy )'a1bM\E΄^!b 3䓂,,, ZG ϣYDRv$ը&]> 9jUKcGl:zݞfƞQ#IѢWqE}"LA2_.n:\^au{)6ë/@L] ߥHً>~?WӠEt%.Ѣ^RfIzhΐ .;_t ֳw7Bn~fϪM5x+J(-gO ]sQ&" aV/8Z0UNb'6%1Fp{eO9޲CT0?# <oWLF27e|~YhDYa[Դ/vwЮ[P=L^uhߴ"N!.S*  92P47Mr B #iĈF[xi$L{5!{@ξXf+.'ް%A&6wK{d91X$6-܋hV<`Q6ҊY'_ g˩ CJˡ6pKVxR?JywPP8c:xgzbP?wIDJy;k D-T,C<\fg7+a#'y'V%ჾI~!e|HmkE4Sݚj" "VnP]7X<±Oju}ns%l:E0ir-JC81gx;2r;t'6cRN 3_P̢ͥ0-tISmW-(AHfַ2wI:ltac~ؕ=d;+ H 0zx`8!Z|"i `geי'~uĒn-; e.oJQ=7* O)\> S^PEϠ4ʇQ~ 6Qij84̉WY?ŕ"=T3*fv{A6SA%w".F_lHnTܯƿ1ٷ*'ק@ż mV mxty*x%5ӛ ]8Apq \bOХ kT+bY}E575r^ 2`+/g,y,d$ѭ &j PKjxZCLc6"fJG{ªsjXzf&ʑvVguH\?[mtn(QDG4^.a箠,@eQ d3Knrb);p01FlK~Ód}w!{sk.1cwoHRScLR\jd]hj,Q:`V8b~6ױwYntslRKsZsU?IEA0SY GX2F_ -6+ e}O`n$,x⊚ȶ*{r'GM! ~GpVCouIhZaBԭzNUPߡ*V/:&֏ M:Ju=ʙ<{G-qSph^(\7 ŀe7C(PMo@v;0 ,7iCfεN!fsۋa MWֺ)}[%>a?- yW;5axԫ&}r>kc0JJ շj?&WB-=r`yI3ABrƜ6| %45IN)N$PF̊cc/xEz]|5FcNd[-szB&%!PQlH9ע˴], u|al[ؕ+i`2A_hBVݹHҤoI/ 1X#,Ҧ۪jWk ]'Ky+[;D19Y2-K ktǁ0uÔ {Ìg9)/B|vK$g=fW Xg zɢWl{կOkbLߔ:H[7/;˨#)}uD͟&ѽ(9fJ!|z)ZvtR΃DR?[Z ZC3 <$Fn/a7ZeLkJCkyboMT̺l>%O%.8ދֆTvJ]E+0Mp<1m>GߟÍ~R8B@KD~Zds;_uU%~Nt/SqX0Nvbn=oY&YŨ=)eLMn3_'G?3@ k9,4%CRb~ZaUfo ,Ӓ-ZEtGI򺞣3cbTn@&T;jV+ --n k R: ˜BYE1b6sHk zW jDgFux)hO">q";.W0/?|ìFϟ `.3:HajnBب\stJRsIgӛ $~D6 elyC}ɹ( toVaG{_[zox0cjz ЛJK+N>Vj4Y7(L0 5q9zhzi5B-(vyzݥ7] 9XF:rTǜ&=2|,#dvBG$U8VvG-g^(M1+De|Ǒ+6,UFN{_\ECaS[^Ԩ!b*WAӼC%ƤDbee3 !HT!cm^>į wr:r {N>U!ʦ`Pö~h^DZl7<=*.ծx`.b㣆=Q9&5*n} 3WؗbY簍!)~)UE:pl+B%kY̔VT"s `<=Ė[Ŝ4U!8xj$Ph)#ly|Sܰ(᪮)K=I:וhA,kߵ7-%]X p*7\?QMR[%Q<4)@<]o[t>BY/yP'7`} Z^#ӐmHV{2Pn!5η6JK$z*'iUL7%K]ەK/iӒ fJFi shI_fdD}'u\ak̕뼹 OgYeu#1oE>qZWTa@`ĺoLEidIAp[&;ӞW`mU<2&`[YFL|EU)YQe¯5v E=~ R{YSVH Co\z^N5o>֜" i t F@ln:$IpX=$ac2D}Š٫[KZIm-O5ԓ@eKڿ* |$|2šn f6fi}!å}':Ք"dۉaļ3=jL꛹\BTKqjj{"̨1+G8$_FXH y(As w!E\pkz8Pdo`v b]0ZT_"2[GhO- +ٹyC- SH~;/Gxs Ba 9.*+e9"`%n&0qv>e&p61ɱtP\YpB Jyl%Y Nthlqg0sw a/Zۻajg>Q郞Krd \ 7uӱ4]% 354BЯ~P*5DėЙ I{ADŷ;&lj/u,@rٕT*=r/UBxN31,b|O ]f/US]'?A@lFY ߒ7?^.7Ἥ)1\D>AxҠxLɥ(w(.A9,ɯ^&%j w¼m:7[gJЙTҿ4R}do[at>'ܬ@aW7ZwibRV=F:dnC?Ȟ~0w'LH3,/CoݧGf`Dzd7%rvpN-=C CO#"m9< 6i"6^Lxк8FR8z38NJtHJgͭlǟ 43 N_#Y)_&J4n*:8EW, k/xuoybZS){Bt#tv+`St£vKcj<ɼEm>!GM'}Q)?Pskkhc;=ۡUVK\n5QNh>hKOR?6Fn^PqЙq<N eZ.hV^]zy#q{᝹.#E3!RפYr|V8u=c髍59r ޷-IbAUk[M.m~īW?5ΐViWs9BJ# (PzM4Q1X{"d;1ջ_ܠEce&(Q?`]IP@Mvpl+UA6Zp D`OuM(CVeP_Sב% r#2cso90)0  +G 1.3.6.1.4.1.11591.12.2TIGER192  ` `GCC: (GNU) 4.2.2$.symtab.strtab.shstrtab.rel.text.data.bss.rodata.rel.data.rel.local.comment.text.__i686.get_pc_thunk.bx.note.GNU-stack.group4 < `6 % +000 <@0H 8 H7@ L0U0r003 p5 !T,T8=JT W`` 8lw {     (tiger.csbox1sbox2sbox3sbox4tiger_inittiger_roundpasskey_scheduletransformtiger_writetiger_finaltiger_readasnoid_spec_tiger__i686.get_pc_thunk.bx_GLOBAL_OFFSET_TABLE_memcpy_gcry_burn_stackmemset_gcry_digest_spec_tiger^d     0 7 u |     " ) g n    O  h n  #  $,48<@rmd160.o/ 1249659006 0 0 100644 16312 ` ELF94( UEEE#EgE@E@ܺE@ vT2E@ËE@E@XUSD$@E D$E$EEE@EE@EE@ EE@EE3E3EMEED$ E$2U‰UD$ M $2EE3E3EMEED$E$2U‰UD$ M $2EE3E3EMEED$E$\2U‰UD$ M $A2EE3E3EMEED$ E$2U‰UD$ M $1EE3E3EMEED$E$1U‰UD$ M $1EE3E3EMEED$E$1U‰UD$ M $f1EE3E3EMEED$E$81U‰UD$ M $1EE3E3EMEED$ E$0U‰UD$ M $0EE3E3EMEčED$ E$0U‰UD$ M $0EE3E3EMEȍED$ E$]0U‰UD$ M $B0EE3E3EME̍ED$E$0U‰UD$ M $/EE3E3EMEЍED$E$/U‰UD$ M $/EE3E3EMEԍED$E$/U‰UD$ M $g/EE3E3EME؍ED$E$9/U‰UD$ M $/EE3E3EME܍ED$ E$.U‰UD$ M $.EE3E3EMEED$E$.U‰UD$ M $.EU#UE#E ЋMEyZED$E$R.U‰UD$ M $7.EU#UE#E ЋMEyZED$E$-U‰UD$ M $-EU#UE#E ЋME؍yZED$E$-U‰UD$ M $-EU#UE#E ЋMEyZED$ E$S-U‰UD$ M $8-EU#UE#E ЋME̍yZED$ E$,U‰UD$ M $,EU#UE#E ЋMEyZED$ E$,U‰UD$ M $,EU#UE#E ЋMEyZED$E$T,U‰UD$ M $9,EU#UE#E ЋMEyZED$E$+U‰UD$ M $+EU#UE#E ЋMEԍyZED$E$+U‰UD$ M $+EU#UE#E ЋMEyZED$ E$U+U‰UD$ M $:+EU#UE#E ЋMEȍyZED$E$+U‰UD$ M $*EU#UE#E ЋMEyZED$ E$*U‰UD$ M $*EU#UE#E ЋMEyZED$ E$V*U‰UD$ M $;*EU#UE#E ЋME܍yZED$E$*U‰UD$ M $)EU#UE#E ЋMEЍyZED$ E$)U‰UD$ M $)EU#UE#E ЋMEčyZED$ E$W)U‰UD$ M $<)EE E3EMEnED$ E$)U‰UD$ M $(EE E3EME̍nED$ E$(U‰UD$ M $(EE E3EME܍nED$E$g(U‰UD$ M $L(EE E3EMEnED$E$(U‰UD$ M $'EE E3EMEȍnED$E$'U‰UD$ M $'EE E3EMEnED$ E$w'U‰UD$ M $\'EE E3EMEčnED$ E$''U‰UD$ M $ 'EE E3EMEnED$E$&U‰UD$ M $&EE E3EMEnED$E$&U‰UD$ M $l&EE E3EMEnED$E$7&U‰UD$ M $&EE E3EMEnED$ E$%U‰UD$ M $%EE E3EMEnED$E$%U‰UD$ M $|%EE E3EME؍nED$E$G%U‰UD$ M $,%EE E3EMEЍnED$ E$$U‰UD$ M $$EE E3EMEnED$E$$U‰UD$ M $$EE E3EMEԍnED$E$W$U‰UD$ M $<$EU#UE#E ЋME-$CpED$ E$$U‰UD$ M $#EU#UE#E ЋMEȍ-$CpED$ E$#U‰UD$ M $#EU#UE#E ЋMEЍ-$CpED$E$X#U‰UD$ M $=#EU#UE#E ЋME̍-$CpED$E$#U‰UD$ M $"EU#UE#E ЋME-$CpED$E$"U‰UD$ M $"EU#UE#E ЋMEč-$CpED$E$Y"U‰UD$ M $>"EU#UE#E ЋMEԍ-$CpED$ E$"U‰UD$ M $!EU#UE#E ЋME-$CpED$E$!U‰UD$ M $!EU#UE#E ЋME؍-$CpED$ E$Z!U‰UD$ M $?!EU#UE#E ЋME-$CpED$E$!U‰UD$ M $ EU#UE#E ЋME-$CpED$E$ U‰UD$ M $ EU#UE#E ЋME-$CpED$E$[ U‰UD$ M $@ EU#UE#E ЋME܍-$CpED$E$ U‰UD$ M $EU#UE#E ЋME-$CpED$E$U‰UD$ M $EU#UE#E ЋME-$CpED$E$\U‰UD$ M $AEU#UE#E ЋME-$CpED$ E$U‰UD$ M $EE E3EME-VED$ E$U‰UD$ M $EE E3EME-VED$E$gU‰UD$ M $LEE E3EME-VED$E$U‰UD$ M $EE E3EMEȍ-VED$ E$U‰UD$ M $EE E3EME-VED$E$wU‰UD$ M $\EE E3EMEԍ-VED$E$'U‰UD$ M $ EE E3EME-VED$ E$U‰UD$ M $EE E3EME̍-VED$ E$U‰UD$ M $lEE E3EME܍-VED$E$7U‰UD$ M $EE E3EME-VED$ E$U‰UD$ M $EE E3EME-VED$ E$U‰UD$ M $|EE E3EMEč-VED$E$GU‰UD$ M $,EE E3EMEЍ-VED$ E$U‰UD$ M $EE E3EME-VED$E$U‰UD$ M $EE E3EME-VED$E$WU‰UD$ M $<EE E3EME؍-VED$E$U‰UD$ M $EEEUUMMEEUUEEE@EE@EE@ EE@EE E3EME拢PED$E$mU‰UD$ M $REE E3EME܍拢PED$ E$U‰UD$ M $EE E3EME拢PED$ E$U‰UD$ M $EE E3EME拢PED$ E$}U‰UD$ M $bEE E3EMEȍ拢PED$ E$-U‰UD$ M $EE E3EME拢PED$E$U‰UD$ M $EE E3EMEЍ拢PED$E$U‰UD$ M $rEE E3EME拢PED$E$=U‰UD$ M $"EE E3EME؍拢PED$E$U‰UD$ M $EE E3EME拢PED$E$U‰UD$ M $EE E3EME拢PED$E$MU‰UD$ M $2EE E3EMEč拢PED$ E$U‰UD$ M $EE E3EME拢PED$E$U‰UD$ M $EE E3EME̍拢PED$E$]U‰UD$ M $BEE E3EME拢PED$ E$ U‰UD$ M $EE E3EMEԍ拢PED$E$U‰UD$ M $EU#UE#E ЋME$M\ED$ E$hU‰UD$ M $MEU#UE#E ЋMEЍ$M\ED$ E$U‰UD$ M $EU#UE#E ЋME$M\ED$E$U‰UD$ M $EU#UE#E ЋME$M\ED$E$iU‰UD$ M $NEU#UE#E ЋME$M\ED$ E$U‰UD$ M $EU#UE#E ЋME؍$M\ED$E$U‰UD$ M $EU#UE#E ЋME$M\ED$ E$jU‰UD$ M $OEU#UE#E ЋME̍$M\ED$ E$U‰UD$ M $EU#UE#E ЋME܍$M\ED$E$U‰UD$ M $EU#UE#E ЋME$M\ED$E$kU‰UD$ M $PEU#UE#E ЋMEč$M\ED$ E$U‰UD$ M $EU#UE#E ЋMEԍ$M\ED$E$U‰UD$ M $EU#UE#E ЋME$M\ED$E$lU‰UD$ M $QEU#UE#E ЋMEȍ$M\ED$E$U‰UD$ M $EU#UE#E ЋME$M\ED$ E$U‰UD$ M $EU#UE#E ЋME$M\ED$ E$mU‰UD$ M $REE E3EME>pmED$ E$U‰UD$ M $EE E3EME>pmED$E$U‰UD$ M $EE E3EME>pmED$E$}U‰UD$ M $bEE E3EME>pmED$ E$-U‰UD$ M $EE E3EME>pmED$E$ U‰UD$ M $ EE E3EME܍>pmED$E$ U‰UD$ M $r EE E3EME>pmED$E$= U‰UD$ M $" EE E3EMEȍ>pmED$E$ U‰UD$ M $ EE E3EMEЍ>pmED$ E$ U‰UD$ M $ EE E3EMEč>pmED$ E$M U‰UD$ M $2 EE E3EMEԍ>pmED$E$ U‰UD$ M $ EE E3EME>pmED$E$ U‰UD$ M $ EE E3EME̍>pmED$ E$] U‰UD$ M $B EE E3EME>pmED$ E$ U‰UD$ M $ EE E3EME>pmED$E$ U‰UD$ M $ EE E3EME؍>pmED$E$m U‰UD$ M $R EU#UE#E ЋMEčvmzED$E$ U‰UD$ M $ EU#UE#E ЋMEvmzED$E$ U‰UD$ M $ EU#UE#E ЋMEvmzED$E$n U‰UD$ M $S EU#UE#E ЋMEvmzED$ E$ U‰UD$ M $EU#UE#E ЋMEvmzED$E$U‰UD$ M $EU#UE#E ЋMEЍvmzED$E$oU‰UD$ M $TEU#UE#E ЋMEvmzED$E$U‰UD$ M $EU#UE#E ЋMEvmzED$E$U‰UD$ M $EU#UE#E ЋMEvmzED$E$pU‰UD$ M $UEU#UE#E ЋMEԍvmzED$ E$U‰UD$ M $EU#UE#E ЋMEvmzED$ E$U‰UD$ M $EU#UE#E ЋME؍vmzED$ E$qU‰UD$ M $VEU#UE#E ЋMEȍvmzED$ E$U‰UD$ M $EU#UE#E ЋMEvmzED$E$U‰UD$ M $EU#UE#E ЋME̍vmzED$E$rU‰UD$ M $WEU#UE#E ЋME܍vmzED$E$U‰UD$ M $EE3E3EMEԍED$E$U‰UD$ M $EE3E3EMEED$E$U‰UD$ M $pEE3E3EME̍ED$ E$BU‰UD$ M $'EE3E3EMEED$ E$U‰UD$ M $EE3E3EMEED$ E$U‰UD$ M $EE3E3EMEED$E$gU‰UD$ M $LEE3E3EMEčED$E$U‰UD$ M $EE3E3EMEED$E$U‰UD$ M $EE3E3EMEED$E$U‰UD$ M $qEE3E3EMEED$ E$CU‰UD$ M $(EE3E3EME؍ED$E$U‰UD$ M $EE3E3EME܍ED$E$U‰UD$ M $EE3E3EMEED$E$hU‰UD$ M $MEE3E3EMEED$ E$U‰UD$ M $EE3E3EMEȍED$ E$U‰UD$ M $EE3E3EMEЍED$ E$U‰UD$ M $rEE@EEEE@EUEPE@ EUEPE@EUEP EEUEPUEĄ[]UEM EE]US$E EEEE@X@u:ED$E$;$E@XE@PEP}E@X$EHXEETQEPXEm}t E@X?~D$D$E$3}t~3ED$E$E@XE@PEPm@E@}?w$$EHXEETQEPXEm}t E@X?~˃$[]UE EE D$E$UEEUE@EUE@EUE@ EUE@EUS4EED$D$E$ E@EEEEEEEE@XEE;EsEEEeeE EE@X7=EPXEDEPXEPXEDEPXE@X7~tEPXEDEPXEPXEDEPXE@X?~D$D$E$!ED$8D$$E‹EPPE‹EPQE‹EPRE‹EPSE‹EPTE‹EPUE‹EPVE‹EPWED$E$$EEUEEUE@EUE@EUE@ EUE@E4[]UEEEUStE$ED$E D$E$E$D$ED$E$t[]0!0 +$1.3.36.3.3.1.21.3.36.3.2.1RIPEMD160357\GCC: (GNU) 4.2.2$.symtab.strtab.shstrtab.rel.text.data.bss.rodata.rel.data.rel.local.rel.data.rel.comment.text.__i686.get_pc_thunk.bx.note.GNU-stack.group4<38 >x%p8+808&<8 8 p?P8( L ?8 Z8c888@< > St333W%5 27>B     RSd {15j7d( rmd160.ctransformrolrmd160_writermd160_finalrmd160_readasnoid_spec_rmd160_gcry_rmd160_init__i686.get_pc_thunk.bx_GLOBAL_OFFSET_TABLE_memcpy_gcry_burn_stack_gcry_rmd160_mixblockmemset_gcry_rmd160_hash_buffer_gcry_digest_spec_rmd160^d ~33  4455 6^777 7)8      rsa.o/ 1249659006 0 0 100644 18436 ` ELF,4(  US4EE $EE $EE $EE $EEEE@ED$E D$E$ED$ED$E$ED$E$ED$ED$E$ED$E$D$E D$E$ED$ED$E$ED$ED$E$ED$E$uPD$ED$E$ED$ED$E$ED$E$tEE$E$E$E$E4[]US$EED$E D$E $E $EE D$ED$E$EE$D$E D$E $E$[]USTt'} w E7k}t E7Y}t EEEȉEE tE }uE$E}uD$)E$MED$E$E $EEEЉẼ}t Ẻ$}t EЉ$}tVE ED$ D$ED$$E̋E ED$ D$ED$$ERE D$ D$ED$$E̋E D$ D$ED$$EЋEЉD$Ẻ$~EЉD$Ẻ$EЉD$ẺD$E$E$;E E̋@$E܋E̋@$EE $EE $EE $ED$ẺD$E܉$D$EЉD$E$ED$E܉D$E$ED$E܉D$E$ED$ED$E$@}t ]D$D$j$D$ED$E$ED$ED$E܉$tE $EԋED$ED$Eԉ$E $E؋EЉD$ẺD$E؉$$ẺD$p$EЉD$v$ED$|$ED$$ED$$ED$$ED$$EԉD$$E؉D$$E܉$E$E$E$E$UEUEBUẺB UEЉBUEԉBUE؉BE @D$E$E$EE@$E@E@ $E@ E@$E@E@$E@E@$E@D$D$ ]D$D$Cj$E2EEăT[]US$E$ED$ED$E$ED$E$ED$E$E$;Et*D$ D$]jD$$E$[]US$$eED$D$eE$D$dE$E$et*D$ D$ljD$$E$[]UVSE}uE} vE tDžd7%}wDžd7EuDžd7EEEEEE}E $ EE $EE$E $EEUD$T$E$E$‹E d9vE$CE;E3E+EbHpEtLxE|PEEESEEEWEEE[EEEEEE`EpD$D$E$E}t2EtD$D$E$E$EEpuEEttEEpuދEpt>EEt$EEpuDždE$EȋUMuD$D$EȉD$ T$L$4$EUMuD$D$EȉD$ T$L$4$EċE$EE$EE$EE$EE$EE$E}t}u0E$Eĉ$Eȉ$DždEĉD$E$~EĉD$E$EE $E̋EĉD$ED$Ẻ$E $E؋E $E܋E $ED$ED$E؉$D$EĉD$E܉$E܉D$E؉D$E$E $EED$EȉD$E$u*:D$ D$ jD$^$E܉D$E؉D$E$E؉EEE܉$EED$ED$E$E$EEEEED$EȉD$EЉ$EEEEĉD$ED$Eԉ$$Etx$ED$$EĉD$$ẺD$$EȉD$$EЉD$$EԉD$$UẺUEȉBUEB UEĉBUEЉBUEԉBE @D$E$5E$EE@$E@E@ $E@ E@$E@E@$E@E@$E@D$D$ :D$D$6j$Džd2 Džddİ[^]US$E@ @$EEPE@ T$D$E$ED$E$EE$}$[]US$E;E uWE @$EEE@T$ D$E D$E$ED$E$E$%EE@T$ D$E D$E$$[]US$E@ tE@t E@u*EE@T$ D$E D$E$E@$EE@$EE@$EE@ D$D$E$EPED$T$E$E@ D$ ED$E D$E$E@D$D$E$EPED$T$E$E@D$ ED$E D$E$ED$ED$E$E@tE@D$ED$E$EPEHT$ ED$L$E$E@ D$ED$E$ED$ED$E$E$E$E$$[]US$E$$EE$$EED$ ED$E D$E$ED$ ED$ED$E$E$E$[]US$E$$EED$ ED$E D$E$E$[]USTEEE}t"D$D$E$EEEȉE}u8D$D$E$E}tEE$}u}u ẺD$ED$ ED$E D$EЉ$EE$}} E̅D$ D$D$E $E}EЉ$EEԉ$EE܉$EE$EE؉$EE$E[D$D$E$E}tEE$ED$ ED$E D$EЉ$E}u?UЋEUEԉUE؉U E܉UEUEET[]U(D$ED$ED$D$ ED$E D$E$qU(EE EE EE EE EE EE EEtEtEu EDE$uEEUS$EEEEE@$‹E E ED$ED$$$[]UVSPEEEEE̋EEЋEEԋE E؋EE܋EEẺ$$EEẺ$$EẺ$$EẺ$D$D$E$ẺD$ED$E$ẺD$ED$E$u E?Eu'ŰMЋE0T$ L$ED$4$`EEEẺD$ED$E$%Eu@E$EE$ẺD$ED$E$EE$Eu!E$E$E$U EEEăP[^]US4EEEEEEE EEEEEE@$‹E E ED$ED$$4[]US$EEEE$EEED$T$E$ E D$E$t EEEEE$E$[]USE $[]US$D$D$E $E}u EDbED$D$E$E}uE$ED+ED$ED$E$E$EE$[]US4EEEED$ K`D$D$E$E}u(D$ KD$D$E$E}tEUE D$T$E$E}t EbUMED$T$ $E}t E5UMED$T$ $EE$8t EE$E$E$E4[]UE$UE]US$D$D$E$E}u ED$D$E$EE$}u EiD$D$E$EE$}u E/D$D$E$EE$EEE$[]USDEEEEEEEEEE$ED$ED$E$ED$ D$D$E܉$E}tE:U܋ED$T$E؉$E}t'E E؉$!E}u8EED$E$uYEU؋E D$T$Eԉ$E}tvEED$T$$E}t D$D$E$EED$D$$E}u EED$E$t EE$E$Eԉ$E$E؉$E܉$E$ED[]US4EEED$ D$D$E$E}u(D$ < D$D$E$E}tE$EEE$E}tE$EgEEUD$$E}uCEEUD$$E}uE$E$EGE$E$}t$ED$ ED$D$$EE2E؃4[]UEtE$iEEE(private-key (rsa (n #00e0ce96f90b6c9e02f3922beada93fe50a875eac6bcc18bb9a9cf2e84965caa 2d1ff95a7f542465c6c0c19d276e4526ce048868a7a914fd343cc3a87dd74291 ffc565506d5bbb25cbac6a0e2dd1f8bcaab0d4a29c2f37c950f363484bf269f7 891440464baf79827e03a36e70b814938eebdc63e964247be75dc58b014b7ea251#) (e #010001#) (d #046129f2489d71579be0a75fe029bd6cdb574ebf57ea8a5b0fda942cab943b11 7d7bb95e5d28875e0f9fc5fcc06a72f6d502464dabded78ef6b716177b83d5bd c543dc5d3fed932e59f5897e92e6f58a0f33424106a3b6fa2cbf877510e4ac21 c3ee47851e97d12996222ac3566d4ccb0b83d164074abf7de655fc2446da1781#) (p #00e861b700e17e8afe6837e7512e35b6ca11d0ae47d8b85161c67baf64377213 fe52d772f2035b3ca830af41d8a4120e1c1c70d12cc22f00d28d31dd48a8d424f1#) (q #00f7a7ca5367c661f8e62df34f0d05c10c88e5492348dd7bddc942c9a8f369f9 35a07785d2db805215ed786e4285df1658eed3ce84f469b81b50d358407b4ad361#) (u #304559a9ead56d2309d203811a641bb1a09626bc8eb36fffa23c968ec5bd891e ebbafc73ae666e01ba7c8990bae06cc2bbe10b75e69fcacb353a6473079d8e9b#)))(public-key (rsa (n #00e0ce96f90b6c9e02f3922beada93fe50a875eac6bcc18bb9a9cf2e84965caa 2d1ff95a7f542465c6c0c19d276e4526ce048868a7a914fd343cc3a87dd74291 ffc565506d5bbb25cbac6a0e2dd1f8bcaab0d4a29c2f37c950f363484bf269f7 891440464baf79827e03a36e70b814938eebdc63e964247be75dc58b014b7ea251#) (e #010001#)))generate_stdrsa.c p= q= phi= g= f= n= e= d= u= self-test after key generation failedgen_x931_parm_xp_gcry_mpi_get_nbits ((xp)) == nbitsgen_x931_parm_xi_gcry_mpi_get_nbits ((xi)) == 101generate_x931Xp1Xp2XpXq1Xq2Xq_gcry_mpi_gcd (g, e, phi)p and q are swapped p q n e d uderive-parmsuse-x931(misc-key-info(p-q-swapped))transient-keyn(data (flags pkcs1) (hash sha1 #11223344556677889900aabbccddeeff80203040#))(data (flags pkcs1) (hash sha1 #11223344556677889900aabbccddeeff10203040#))converting data failedsigning failedverify failedbad signature not detectedenc-valrsaa(data (flags raw) (value %m))encrypt failedgcry_pk_decrypt returned garbageciphertext matches plaintextdecrypt failedvaluedecrypt returned no plaintextmismatchconvertkey consistencysignencryptpubkeyopenpgp-rsaoid.1.2.840.113549.1.1.1RSAnenedpqus   W<7R@"wGCC: (GNU) 4.2.2$.symtab.strtab.shstrtab.rel.text.data.bss.rodata.rel.data.rel.local.comment.text.__i686.get_pc_thunk.bx.note.GNU-stack.group4 /<l" ; %"+"0" <+l 8 dG LL,U^,rb,b,D/p/ 5 =+52<CR] d[q:8 yuQR?W1`=<I7R]R%kw{L`L#Qt D |@",    3IWky,:Net'=Pcz (<K\jz <\rsa.csample_secret_keysample_public_keytest_keyspublicsecretcheck_exponent__FUNCTION__.5863generate_std__FUNCTION__.5942gen_x931_parm_xp__FUNCTION__.5955gen_x931_parm_xi__FUNCTION__.6004generate_x931check_secret_keyrsa_blindrsa_unblindrsa_generate_extrsa_generatersa_check_secret_keyrsa_encryptrsa_decryptrsa_signrsa_verifyrsa_get_nbitscompute_keygripsample_data_bad.6480sample_data.6479selftest_sign_1024gcry_err_codegpg_err_codeextract_a_from_sexpselftest_encr_1024selftests_rsarun_selftestsrsa_names__i686.get_pc_thunk.bx_GLOBAL_OFFSET_TABLE__gcry_mpi_new_gcry_mpi_randomize_gcry_mpi_cmp_gcry_mpi_add_ui_gcry_mpi_release_gcry_mpi_sub_ui_gcry_mpi_alloc_like_gcry_mpi_gcd_gcry_fips_mode_gcry_mpi_alloc_gcry_mpi_set_ui_gcry_generate_secret_prime_gcry_mpi_swap_gcry_mpi_mul_gcry_mpi_get_nbits_gcry_mpi_alloc_secure_gcry_mpi_snew_gcry_mpi_fdiv_q_gcry_bug_gcry_mpi_invm_gcry_get_debug_flag_gcry_log_mpidump_gcry_fips_signal_error_gcry_mpi_set_highbit_gcry_mpi_set_bit_gcry_assert_failed_gcry_mpi_sub_gcry_sexp_find_token_gcry_sexp_nth_mpi_gcry_sexp_release_gcry_mpi_alloc_set_ui_gcry_derive_x931_prime_gcry_log_debug_gcry_mpi_free_gcry_mpi_powm_gcry_mpi_set_gcry_mpi_fdiv_r_gcry_mpi_add_gcry_mpi_mulm_gcry_sexp_new_gcry_mpi_mod_gcry_mpi_copy_gcry_sexp_nth_data_gcry_md_write_gcry_sexp_sscan_gcry_pk_sign_gcry_pk_verify_gcry_sexp_build_gcry_pk_encrypt_gcry_pk_decrypt_gcry_strerror_gcry_pk_testkey_gcry_pubkey_spec_rsa_gcry_pubkey_extraspec_rsa/ 0 1.1<1J1x2332<3Z435555/ 067845N4c/i 0n9:;;1<5M5g z< <<< 3#=<>G?^@o@}AAA66>8B) ; CC]4v8ADADE F F F( 0F= EFR ZFg oF| F F55555/5F5^5v555   G/  0A52JH_Ij?u   J/ 0A2H?  # + JD /J 0 A 56 KA ?Z 5       LK MX N 5 O PR P` 5r 5 5 5 5 5 5 5 5 3% =9 1U >b Ar A A 6 6 > A 8   %J>8V5vB5DDE Q  F! )F6 >FK SF` hFu }F55 5#5;5S5c u  G/ 0:>3R:/@ 0X:STRS/ 0S7@M@c@6US6US7K]VW>VRRR/ 0?A?A=S]Wh5}/ 0?AW/ 0 L4 CL^No9N X55,5>5P5b5y LN/ 0 :E/K 0?A?A?A?2*YCDZ55555?/E 0:/ 01 3E5Z/` 0m?/ 0 L[N\N+/1 0[ r] ] ^ _  *_C QN\NgN/ 0 L LN 'L5N_MmN/ 012 `( IaX z 3 b  L M7 MF ] 3g u N 5 N 5 N N 5 / 0  !]%! >>000___^^^ 999GGG]]]===ZZZQQQVVVlllMMM fff---ttt+++ LLL444~~~vvvmmm111XXX:::aaa222SSS"""DDDzzz$$$```iiiPPP}}}bbbTTT[[[dddHHHuuu ???\\\JJJ333sssgggRRR&&&777;;;oooKKKccc...yyynnn)))///YYYxxxjjjFFFqqq%%%BBBrrrUUU 666III***hhh<<<888@@@((({{{CCCwwwXXXgggNNN jjj]]]FFF'''222KKKBBB:::%%%{{{ qqq___>>>|||```444MMMrrrzzz555aaaZZZ$$$VVV@@@ccc 333hhh oooSSSbbb...(((ttt666"""888ddd999,,,000DDDeeekkk###HHHQQQUUUAAACCC///<<<+++ GGG~~~)))!!!fff;;;777LLLnnnvvv---&&&}}}\\\OOO???yyyRRRmmm^^^iii111 uuuJJJWWWEEEsssYYYlllTTTxxxpppIIIPPPwww***[[[===888AAAvvvٓ```rrr«uuuWWWɢҐ'''IIICCC\\\>>>gggnnn///ⅅ SSSeee꣣쀀---kkk+++666ņMMM333fffXXX::: xxxBBB&&&aaa???;;;Ԙ苋 ,,,oooNNN yyy"""YYY===tttTTT000~~~(((UUUhhhPPP111***ppp222iiibbb$$$EEEsssmmmJJJ...%%%HHH{{{οqqq)))llldddcccKKK___FFF777^^^GGG[[[ZZZ<<>>^^^ 999]]]ZZZQQQlllttt+++444vvvmmm:::222SSSzzz$$$```iiibbbTTTddduuu ݇͐sssRRRƁoooccc)))///xxxqqqԫrrr666***<<<@@@ӻCCCwww'''555 AAA!!!NNNeee000___GGG===VVVMMM fff--- LLL~~~111XXXaaa"""DDDPPP}}}[[[HHH???\\\JJJ333ggg&&&777;;;KKK...yyynnnYYYjjjFFF%%%BBBUUU IIIhhh888((({{{ǞGCC: (GNU) 4.2.2$.symtab.strtab.shstrtab.rel.text.data.bss.rodata.comment.text.__i686.get_pc_thunk.bx.note.GNU-stack.groupn4 < X %ț+ț0 8A^ut  $ ,<  Ld{?55J\_{0ĖeG)1cZ1camellia.ccamellia_sp1110camellia_sp0222camellia_sp3033camellia_sp4404_gcry_camellia_setup128__i686.get_pc_thunk.bx_GLOBAL_OFFSET_TABLE__gcry_camellia_setup256_gcry_camellia_setup192memcpy_gcry_camellia_encrypt128_gcry_camellia_decrypt128_gcry_camellia_encrypt256_gcry_camellia_decrypt256_gcry_Camellia_Ekeygen_gcry_Camellia_EncryptBlock_gcry_Camellia_DecryptBlock  H Z g {      $ 1 E \ g {       % 9 F                1 >         \ n {      , > K _ v      - A X c w      ! "! -! A! N! "5(5 B5_5|555555 /6 F6 _6 x6 6 6 6 6 37 J7 c7 |7 7 7 7 7 ?8 V8 o8 8 8 8 8 8 C9 Z9 s9 9 9 9 9 9 O: f: : : : : : : S; j; ; ; ; ; ; ; = = 6= O= h= |= = =  > !> :> S> o> > > > ? -? F? _? x? ? ? ? @ 1@ J@ c@ @ @ @ @ &A =A VA oA A A A A *B AB ZB sB B B B B C C D ,D ED YD oD D D E E 4E PE gE E E E F +F DF ]F qF F F G G 3G LG hG G G G H *H CH \H uH H H H I 2I KI dI I I I I JJ J  K #K  P g    Ɖ ܉  T k    Њ   ` w   ‹ ֋   d {   Ɍ    p    ҍ    t    َ    ' > W p    Ɛ + B [ t    ֑ 7 N g    Ò ֒ ; R k    Г  G ^ w    Ӕ  K b {   Ǖ   #msha256.o/ 1249659006 0 0 100644 6416 ` ELF,4(  UEEEg jE@gE@rnm1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqshort string# }"4"BwU*你labclong stringu8Q'v]]PE\RR%%abcdbcdecdefdefgefghfghighijhijkijkljklmklmnlmnomnopnopqone million "a" yFU ػaK?BXHNgdigestxAA@]"#aza$ja8& >`9gH m9,2.16.840.1.101.3.4.2.42.16.840.1.101.3.4.2.11.2.840.113549.1.1.11SHA224SHA2561H_uqp h | p h GCC: (GNU) 4.2.2$.symtab.strtab.shstrtab.rel.text.data.bss.rodata.rel.data.rel.local.comment.text.__i686.get_pc_thunk.bx.note.GNU-stack.group4 <  @8 %$ &+L 0`  < 8 x LUr0  qqq"){3]7pWD:Q ] ?nT ? T      (7HU`(nsha256.csha256_initsha224_initK.5652transformrorsha256_writesha256_finalsha256_readselftests_sha224selftests_sha256run_selftestsasn224oid_spec_sha224asn256oid_spec_sha256__i686.get_pc_thunk.bx_GLOBAL_OFFSET_TABLE__gcry_burn_stackmemset_gcry_hash_selftest_check_one_gcry_digest_spec_sha224_gcry_digest_extraspec_sha224_gcry_digest_spec_sha256_gcry_digest_extraspec_sha256  x~   # ) : L d        8 \ b h y         C w   $,48<@H`dltx|sha512.o/ 1249659006 0 0 100644 9492 ` ELF,4(  UEEEɼ@g jE@;ʄ@ gE@+@rn+@,hE@0kA@4كE@8y!~@<[E@@@DEǀUEEE؞@]ˋE@|6@ *)bE@p0@ZYE@9Y@/E@ 1 @$g&3gE@(Xh@,JE@0d@4 . ۋE@8O@<HGE@@@DEǀUWVS\EPEUEP @EUEP@EUEP@EUEP$@ EUEP,@(EUEP4@0EUċEP<@8EȉUEEU܃E E U܃E E U܃E E U܃E E U܃E E U܃E E U܃E E E E܈E EE}aEEԉEԃƉ׉Eԃ1Ƌ1׋Eԃ11Mԃ׉EԃƉ׉Eԃ1Ƌ1׋Eԃ11׋EԃE}OEEUƉ׉EU1Ƌ1׋EU11Ɖu}̉EU}!ljE!ЉMuЉҋu!Ƌ}!׋11׋Eԋ׋EԋEUEUƉ׉EUƉ׉11u}11EUu!Ƌ}!׋MEE!ȋ#U11щ   EUu!Ƌ}!׋1 1EUEUĉEȉŰEUEUċEUEUEUEUEUEUEUEUEUEUEUEUEUEUE}OHEPEUMQEP @EUMAQ EP@EUMAQEP@EUMAQEP$@ EUMA Q$EP,@(EUMA(Q,EP4@0EUċMA0Q4EP<@8EŰMA8Q<\[^_]US$E EEEE=uFEHD$E$$EǀEPD@@MA@QD} E*EEETHQEEm}tE~D$D$E$}?ED$E$8EǀEPD@@MA@QDEm}w$*EEETHQEEm}tE~ƒ$[]UWVSLEED$D$E$>E̋PD@@EЉUԋEЋUEUEЋUԉ1E؉U܋EUEЉUԋE̋EUEUEUU;UwE;ErU;UsEUEUEЉUԋEU҉EUE؋U҉E؉U܋EЋUԉƉ׉1E U E؉U܋E̋oOE̋EDHẺE̋EDHẺE̋o~E̋EDHẺE̋EDHẺE̋~D$D$E$ẼHD$pD$$E؋U܉1‹ËE؋U܉1‹ËE؋U܉1‹ËE؋U܉1҉‹ËE؋U‹ËE؋U‹ËE؋U‹ËE؉‹ËEU1‹ËEU1‹ËEU1‹ËEU1҉‹ËEU‹ËEU‹ËEU‹ËE‹ËẼHD$Ẻ$I$ẼHEE̋P1‹EEE̋P1‹EEE̋P1‹EEE̋P1҉‹EEE̋P‹EEE̋P‹EEE̋P‹EEE̋P‹EEE̋P @1‹EEE̋P @1‹EEE̋P @1‹EEE̋P @1҉‹EEE̋P @‹EEE̋P @‹EEE̋P @‹EEE̋P @‹EEE̋P@1‹EEE̋P@1‹EEE̋P@1‹EEE̋P@1҉‹EEE̋P@‹EEE̋P@‹EEE̋P@‹EEE̋P@‹EEE̋P@1‹EEE̋P@1‹EEE̋P@1‹EEE̋P@1҉‹EEE̋P@‹EEE̋P@‹EEE̋P@‹EEE̋P@‹EEE̋P$@ 1‹EEE̋P$@ 1‹EEE̋P$@ 1‹EEE̋P$@ 1҉‹EEE̋P$@ ‹EEE̋P$@ ‹EEE̋P$@ ‹EEE̋P$@ ‹EEE̋P,@(1‹EEE̋P,@(1‹EEE̋P,@(1‹EEE̋P,@(1҉‹EEE̋P,@(‹EEE̋P,@(‹EEE̋P,@(‹EEE̋P,@(‹EEE̋P4@01‹EEE̋P4@01‹EEE̋P4@01‹EEE̋P4@01҉‹EEE̋P4@0‹EEE̋P4@0‹EEE̋P4@0‹EEE̋P4@0‹EEE̋P<@81‹EEE̋P<@81‹EEE̋P<@81‹EEE̋P<@81҉‹EEE̋P<@8‹EEE̋P<@8‹EEE̋P<@8‹EEE̋P<@8‹EEL[^_]UEEEHUS4ED$0D$D$ D$D$$ E}}ED$0D$D$ pD$D$$ E}uQyED$0D$D$ D$D$$ E}u E1} t$ED$ ED$D$ $E E2E4[]US4ED$@D$D$ D$D$$ E}}ED$@D$D$ pD$D$$ E}uQyED$@LD$D$ D$D$$ E}u E1} t$ED$ ED$D$ $E E2E4[]U(EE} t} t.ED$E $VEED$E $~EEE0Q0  `He@0A0  `He0"(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDlshort stringu?E^=iP',2c`ZC[퀆+#X4%abclong string 3 3G=/ǂGS;;/U~-ft`9abcdefghbcdefghicdefghijdefghijkefghijklfghijklmghijklmnhijklmnoijklmnopjklmnopqklmnopqrlmnopqrsmnopqrstnopqrstuone million "a" qdtnN1 JHRyrpL*[8뮗=digestݯ5azAsI A1N~ KUӚ!*'O6<#EMD#d<*OLuڌ(?wyrP(I3ĵC:)&T^[K H= idN.BǼc; D(V2sD~ LC,w\,I.N2.16.840.1.101.3.4.2.31.2.840.113549.1.1.13SHA5122.16.840.1.101.3.4.2.21.2.840.113549.1.1.12SHA384@& 4L0& 4GCC: (GNU) 4.2.2$.symtab.strtab.shstrtab.rel.text.data.bss.rodata.rel.data.rel.local.comment.text.__i686.get_pc_thunk.bx.note.GNU-stack.group4 < 4#@ %&+0 < 8 t$ LUr  ! ")f3&@ MY?j?{4T L     " (;HY`(rsha512.csha512_initsha384_initk.5662transformsha512_writesha512_finalsha512_readselftests_sha384selftests_sha512run_selftestssha512_asnoid_spec_sha512sha384_asnoid_spec_sha384__i686.get_pc_thunk.bx_GLOBAL_OFFSET_TABLE__gcry_burn_stackmemset_gcry_hash_selftest_check_one_gcry_digest_spec_sha512_gcry_digest_extraspec_sha512_gcry_digest_spec_sha384_gcry_digest_extraspec_sha384sy   .4 qi    %     " 3 E ]l }      , Da r      $,48<@HLP`dltx|sha1.o/ 1249659006 0 0 100644 13208 ` ELF -4(  UEEE#EgE@E@ܺE@ vT2E@ËE@E@XUVtv#EEEMUE E UE E UE E E EE EE}~EEE@EE@EE@ EE@ED$E$"‹E3E#E3E‹EEyZED$M $"ED$E$"‹E3E#E3E‹EEyZED$M $g"ED$E$Q"‹E3E#E3E‹EEyZED$M $"ED$E$"‹E3E#E3E‹EEyZED$M $!ED$E$!‹E3E#E3E‹EčEyZED$M $!ED$E$s!‹E3E#E3E‹EȍEyZED$M $?!ED$E$)!‹E3E#E3E‹E̍EyZED$M $ ED$E$ ‹E3E#E3E‹EЍEyZED$M $ ED$E$ ‹E3E#E3E‹EԍEyZED$M $a ED$E$K ‹E3E#E3E‹E؍EyZED$M $ ED$E$ ‹E3E#E3E‹E܍EyZED$M $ED$E$‹E3E#E3E‹EEyZED$M $ED$E$m‹E3E#E3E‹EEyZED$M $9ED$E$#‹E3E#E3E‹EEyZED$M $ED$E$‹E3E#E3E‹EEyZED$M $ED$E$‹E3E#E3E‹EEyZED$M $[EUE1‹E1‹E1MD$E$.‹E3E#E3E4D$M $ EEEyZED$E$EUE1‹E1‹E1MD$E$‹E3E#E3E4D$M $EEEyZED$E$kEUE1‹E1‹E1MD$E$>‹E3E#E3E4D$M $EEEyZED$E$EUE1‹E1‹E1MD$E$‹E3E#E3E4D$M $EEEyZED$E${EUċE1‹E1‹E1MD$E$N‹E3E3E4D$M $-EċEčEnED$E$EUȋE1‹E1‹E1MD$E$‹E3E3E4D$M $EȋEȍEnED$E$EŰE1‹E1‹E1MD$E$d‹E3E3E4D$M $CE̋E̍EnED$E$EUЋE1‹E1‹Eĉ1MD$E$‹E3E3E4D$M $EЋEЍEnED$E$EUԋE1‹E1‹Eȉ1MD$E$z‹E3E3E4D$M $YEԋEԍEnED$E$2EU؋E1‹E1‹Ẻ1MD$E$‹E3E3E4D$M $E؋E؍EnED$E$EU܋E1‹E1‹EЉ1MD$E$‹E3E3E4D$M $oE܋E܍EnED$E$HEUE1‹E1‹Eԉ1MD$E$‹E3E3E4D$M $EEEnED$E$EUE1‹E1‹E؉1MD$E$‹E3E3E4D$M $EEEnED$E$^EUE1‹E1‹E܉1MD$E$1‹E3E3E4D$M $EEEnED$E$EUE1‹E1‹E1MD$E$‹E3E3E4D$M $EEEnED$E$tEUE1‹E1‹E1MD$E$G‹E3E3E4D$M $&EEEnED$E$EUE1‹E1‹E1MD$E$‹E3E3E4D$M $EEEnED$E$EUE1‹E1‹E1MD$E$]‹E3E3E4D$M $<EEEnED$E$EUE1‹E1‹E1MD$E$‹E3E3E4D$M $EEEnED$E$EUE1‹E1‹E1MD$E$s‹E3E3E4D$M $REEEnED$E$+EUċE1‹E1‹E1MD$E$‹E3E3E4D$M $EċEčEnED$E$EUȋE1‹E1‹E1MD$E$‹E3E3E4D$M $hEȋEȍEnED$E$AEŰE1‹E1‹E1MD$E$‹E3E3E4D$M $E̋E̍EnED$E$EUЋE1‹E1‹Eĉ1MD$E$‹E3E3E4D$M $~EЋEЍEnED$E$WEUԋE1‹E1‹Eȉ1MD$E$*U#UE E#E Ѝ4D$M $EԋEԍE-$CpED$E$EU؋E1‹E1‹Ẻ1MD$E$U#UE E#E Ѝ4D$M $E؋E؍E-$CpED$E$]EU܋E1‹E1‹EЉ1MD$E$0U#UE E#E Ѝ4D$M $E܋E܍E-$CpED$E$EUE1‹E1‹Eԉ1MD$E$U#UE E#E Ѝ4D$M $EEE-$CpED$E$cEUE1‹E1‹E؉1MD$E$6U#UE E#E Ѝ4D$M $ EEE-$CpED$E$EUE1‹E1‹E܉1MD$E$U#UE E#E Ѝ4D$M $EEE-$CpED$E$iEUE1‹E1‹E1MD$E$<U#UE E#E Ѝ4D$M $EEE-$CpED$E$EUE1‹E1‹E1MD$E$U#UE E#E Ѝ4D$M $EEE-$CpED$E$oEUE1‹E1‹E1MD$E$BU#UE E#E Ѝ4D$M $EEE-$CpED$E$EUE1‹E1‹E1MD$E$U#UE E#E Ѝ4D$M $EEE-$CpED$E$uEUE1‹E1‹E1MD$E$HU#UE E#E Ѝ4D$M $EEE-$CpED$E$ EUE1‹E1‹E1MD$E$ U#UE E#E Ѝ4D$M $ EEE-$CpED$E${ EUċE1‹E1‹E1MD$E$N U#UE E#E Ѝ4D$M $% EċEčE-$CpED$E$ EUȋE1‹E1‹E1MD$E$ U#UE E#E Ѝ4D$M $ EȋEȍE-$CpED$E$ EŰE1‹E1‹E1MD$E$T U#UE E#E Ѝ4D$M $+ E̋E̍E-$CpED$E$ EUЋE1‹E1‹Eĉ1MD$E$ U#UE E#E Ѝ4D$M $ EЋEЍE-$CpED$E$ EUԋE1‹E1‹Eȉ1MD$E$Z U#UE E#E Ѝ4D$M $1 EԋEԍE-$CpED$E$ EU؋E1‹E1‹Ẻ1MD$E$ U#UE E#E Ѝ4D$M $ E؋E؍E-$CpED$E$ EU܋E1‹E1‹EЉ1MD$E$` U#UE E#E Ѝ4D$M $7 E܋E܍E-$CpED$E$ EUE1‹E1‹Eԉ1MD$E$ U#UE E#E Ѝ4D$M $ EEE-$CpED$E$ EUE1‹E1‹E؉1MD$E$f ‹E3E3E4D$M $E EEE-*>5ED$E$ EUE1‹E1‹E܉1MD$E$‹E3E3E4D$M $EEE-*>5ED$E$EUE1‹E1‹E1MD$E$|‹E3E3E4D$M $[EEE-*>5ED$E$4EUE1‹E1‹E1MD$E$‹E3E3E4D$M $EEE-*>5ED$E$EUE1‹E1‹E1MD$E$‹E3E3E4D$M $qEEE-*>5ED$E$JEUE1‹E1‹E1MD$E$‹E3E3E4D$M $EEE-*>5ED$E$EUE1‹E1‹E1MD$E$‹E3E3E4D$M $EEE-*>5ED$E$`EUE1‹E1‹E1MD$E$3‹E3E3E4D$M $EEE-*>5ED$E$EUċE1‹E1‹E1MD$E$‹E3E3E4D$M $EċEčE-*>5ED$E$vEUȋE1‹E1‹E1MD$E$I‹E3E3E4D$M $(EȋEȍE-*>5ED$E$EŰE1‹E1‹E1MD$E$‹E3E3E4D$M $E̋E̍E-*>5ED$E$EUЋE1‹E1‹Eĉ1MD$E$_‹E3E3E4D$M $>EЋEЍE-*>5ED$E$EUԋE1‹E1‹Eȉ1MD$E$‹E3E3E4D$M $EԋEԍE-*>5ED$E$EU؋E1‹E1‹Ẻ1MD$E$u‹E3E3E4D$M $TE؋E؍E-*>5ED$E$-EU܋E1‹E1‹EЉ1MD$E$‹E3E3E4D$M $E܋E܍E-*>5ED$E$EUE1‹E1‹Eԉ1MD$E$‹E3E3E4D$M $jEEE-*>5ED$E$CEUE1‹E1‹E؉1MD$E$‹E3E3E4D$M $EEE-*>5ED$E$EUE1‹E1‹E܉1MD$E$‹E3E3E4D$M $EEE-*>5ED$E$YEUE1‹E1‹E1MD$E$,‹E3E3E4D$M $ EEE-*>5ED$E$EUE1‹E1‹E1MD$E$‹E3E3E4D$M $EEE-*>5ED$E$oEEMEE@MEPE@MEPE@ MEP E@MEPm}t^]UEM EE]US$E EEEE@X@uBED$D$E$$hE@XE@PEP}E@Xt\$EHXEETQEPXEm}t E@X?~D$D$E$/}EE}tFED$ED$E$XE@XE@UEPE)EEE$h$EHXEETQEPXEm}t E@X?~˃$[]US4EED$D$E$TE@EEEEEEEE@XEE;EsEEEeeE EE@X7=EPXEDEPXEPXEDEPXE@X7~tEPXEDEPXEPXEDEPXE@X?~D$D$E$iED$8D$$E‹EPPE‹EPQE‹EPRE‹EPSE‹EPTE‹EPUE‹EPVE‹EPWED$D$E$$hEEE‹EEE‹EEE‹EEE‹EEE@‹EEE@‹EEE@‹EEE@‹EEE@‹EEE@‹EEE@‹EEE@‹EEE@ ‹EEE@ ‹EEE@ ‹EEE@ ‹EEE@‹EEE@‹EEE@‹EEE@‹EE4[]UEEEUStE$ED$E D$E$E$PD$ED$E$t[]US4ED$ D$D$ "D$D$$E}}&ED$2D$D$ 8HD$D$$E}uQED$D$D$ D$D$$E}u E1} t$ED$ ED$D$$E E2E4[]UEtED$E $EEE0!0 +short string>6Gj>%qxPl؝abclong string>D;nJQ)Fpabcdbcdecdefdefgefghfghighijhijkijkljklmklmnlmnomnopnopqone million "a"4<ڤ+ۭ'1e4odigest1.2.840.113549.1.1.51.2.840.10040.4.31.3.14.3.2.261.3.14.3.2.291.2.840.10045.4.1SHA1#q%(\*GCC: (GNU) 4.2.2$.symtab.strtab.shstrtab.rel.text.data.bss.rodata.rel.data.rel.local.comment.text.__i686.get_pc_thunk.bx.note.GNU-stack.group4 <* h2 %*++0+< ,L 8 03h Ll,U~,r,,d/ D1#SS## #y+q%[6(@D)?O*3]a   o (d (Hsha1.csha1_inittransformrolsha1_writesha1_finalsha1_readselftests_sha1run_selftestsasnoid_spec_sha1__i686.get_pc_thunk.bx_GLOBAL_OFFSET_TABLE__gcry_burn_stackmemset_gcry_sha1_hash_buffermemcpy_gcry_hash_selftest_check_one_gcry_digest_spec_sha1_gcry_digest_extraspec_sha1$$ F$0%y%% &<'(( :)L)R) X) i) {) )) ) ) )) * 3*g*       $,48<@Hhash-common.o/ 1249659006 0 0 100644 1804 ` ELF4( USEEE$;EtD$ED$E$E}t)E t tnEUT$UT$$\D$D$a$E!UD$D$$E}~ =E}u;UED$$EED$ED$E$t NEE$E쉅[]digest size does not match expected sizegcry_md_open failedinvalid DATAMODEdigest mismatchGCC: (GNU) 4.2.2$.symtab.strtab.shstrtab.rel.text.data.bss.rodata.comment.text.__i686.get_pc_thunk.bx.note.GNU-stack.groupn4 <p p %+0^8 A^  u@   p-DZqhash-common.c_gcry_hash_selftest_check_one__i686.get_pc_thunk.bx_GLOBAL_OFFSET_TABLE__gcry_md_get_algo_dlen_gcry_md_open_gcry_md_writememset_gcry_md_readmemcmp_gcry_md_close   * 5 Zi   <F Tseed.o/ 1249659006 0 0 100644 20924 ` ELF=4(  US4EEu7ǃ*tD$@$t E2`}t E,NE E 1‹E 1‹E 1ЉEE E 1‹E 1‹E 1ЉEE E 1‹E 1‹E 1ЉEE E 1‹E 1‹E 1ЉEE$EU‹E)ȉEEE+EEEE1E1E 1‹EEEE1E1E 1‹EEEu.EEEE1ЉEEE1ЉE,EEEE1ЉEEE1ЉEE}EE؃4[]US$EEED$E D$E$E$(E$[]U EE1‹E1‹E1ЉEEE1‹E1‹E1ЉEEE 1‹E 1‹E 1ЉEE E 1‹E1‹E1ЉEE3EEE@3EEUE1ЉEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEE1EE1EE@3EEE@ 3EEUE1ЉEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEE1EE1EE@3EEE@3EEUE1ЉEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEE1EE1EE@3EEE@3EEUE1ЉEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEE1EE1EE@ 3EEE@$3EEUE1ЉEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEE1EE1EE@(3EEE@,3EEUE1ЉEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEE1EE1EE@03EEE@43EEUE1ЉEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEE1EE1EE@83EEE@<3EEUE1ЉEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEE1EE1EE@@3EEE@D3EEUE1ЉEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEE1EE1EE@H3EEE@L3EEUE1ЉEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEE1EE1EE@P3EEE@T3EEUE1ЉEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEE1EE1EE@X3EEE@\3EEUE1ЉEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEE1EE1EE@`3EEE@d3EEUE1ЉEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEE1EE1EE@h3EEE@l3EEUE1ЉEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEE1EE1EE@p3EEE@t3EEUE1ЉEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEE1EE1EE@x3EEE@|3EEUE1ЉEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEE1EE1EE‹E U EU EU EU EU EU EU EU EU EU EU EU EU EU EU EUS$EEED$E D$E$}$$[]U EE1‹E1‹E1ЉEEE1‹E1‹E1ЉEEE 1‹E 1‹E 1ЉEE E 1‹E1‹E1ЉEE@x3EEE@|3EEUE1ЉEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEE1EE1EE@p3EEE@t3EEUE1ЉEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEE1EE1EE@h3EEE@l3EEUE1ЉEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEE1EE1EE@`3EEE@d3EEUE1ЉEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEE1EE1EE@X3EEE@\3EEUE1ЉEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEE1EE1EE@P3EEE@T3EEUE1ЉEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEE1EE1EE@H3EEE@L3EEUE1ЉEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEE1EE1EE@@3EEE@D3EEUE1ЉEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEE1EE1EE@83EEE@<3EEUE1ЉEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEE1EE1EE@03EEE@43EEUE1ЉEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEE1EE1EE@(3EEE@,3EEUE1ЉEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEE1EE1EE@ 3EEE@$3EEUE1ЉEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEE1EE1EE@3EEE@3EEUE1ЉEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEE1EE1EE@3EEE@3EEUE1ЉEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEE1EE1EE@3EEE@ 3EEUE1ЉEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEE1EE1EE3EEE@3EEUE1ЉEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEEE1E1E 1ЉEUEEE1EE1EE‹E U EU EU EU EU EU EU EU EU EU EU EU EU EU EU EUS$EEED$E D$E$}$$[]USD$TD$|$XdD$lD$|$D$DD$l$tth^lD$lD$|$D$dD$l$th DžhhĤ[])TPD ,$!%\QM@CCPQA< `cC#( (D@D  "%xsK;;.pp@0 <3?(0226tpD4, TSG\PLXSK=$ $ psC3 2, ,'prB2 ``@ PP@#+  6LCO7XRJxpH8&/`aA!4@AAPRB|qM=  PSC7!=trF6,#/$#'0 +"lbN.LAM haI)|pL<  ?/3>d`D$,".HCK   !!hcK+dbF&5 3|rN>xrJ:DCG%$"&-!000437.426 ""8084'DAEL@L )415 <0 <2><*:LBNTQE83 ;h`H(|sO?HBJ TRFtsG7 -DBF5(# +daE%:#91\RN9&2011*laM-\SO$0 82 :XPH`bB"(! )033( xqI9hbJ*(" *088(! -,&ܳ38/`@ `QET@DDcO/lcK+hSKXbB"`3305! )( "ࣇ'Б <264CK H/쀈`L,l(4AED!3?<1 =< ((BNL62><%9 # +(bF&drJ:x#'$#/,1rB2pBB@AA@sC3pcG'd, 7- ,,*044 .)QM\8SGT. ̂9?qM=|1105 bJ*h1 "" `H(hqA1pؑaA!`>&QIXQAPܒ#+Ё CGD #,쁍 ?sK;xPL\"!cC#`## AM LȒ2 :8 ".,:bN.lRJX23AI HpH8x ;p@0pqE5tsO?|154`D$daM-lpD4t԰4* rF6t >@@@ ్=:0" *(RN\)RFTCC@ 0%@HHqI9x<!!  SO\sG7tPDT2 !%$COLBFD-PHXRBP+rN>| =000aE%d0 <<6$䳋;pL<| P@P1 98"&$220aI)h374' $$$ SCP @L L3 ;8BJ H7)DTP ,%$!M\QC@CAPQ< C#`c(( DD@  "%K;xs;.@0pp ?<3(2026D4tp, GTSL\PKXS=$$ C3ps 2 ,, 'B2prц @ ``@PP#+ 6OLC7JXRH8xp&/A!`aÄ4A@ABPRM=|q  CPS7!=F6tr/,#'$#0  +"N.lbM LAI)haL<|p  ?/3>D$d`.,"K HC ! !K+hcF&db5 3N>|rJ:xrGDC%&$"-Ӂ!000743.642" "8804'EDAL L@)541  <<0A1pqÉ E5tq;8IXQ?I HA 981G'dcӈ8 B@B# #L,l`ӄ$4401HH@O/lc =<1 -,!@@@>><2<*:NLBETQ ;83H(h`O?|sJ HBFTRG7ts -FDB5 +(#E%da:#91N\R9&2101*M-laO\S$0  :82HXPB"`b )(!303( I9xqJ*hb *("880(-,! &38/ ``@TQED@D/lcO+hcKXSK"`bB3035)(! "' <642 HCK/,l`L(4DAE!?<3=<1 (( LBN6><2%9  +(# &dbF:xrJ'$#/,#12prB@BB@AA3psC'dcG, 7- ,, *440  .)\QM8TSG. 9?=|qM1015 *hbJ1 " "(h`H1pqA!`aA>&XQIPQA#+ DCG #, ?;xsK\PL"!#`cC# # LAM:82 .,":.lbNXRJ23 HAI8xpH ;0pp@5tqE?|sO541$d`D-laM4tpD4*  6trF >@@@ =:0*(" \RN)TRF@CC 0%H@H9xqI<! !  \SO7tsGTPD2 %$!LCODBF-XPHPRB+>|rN =000%daE<<0 6$;<|pL PP@981 &$"202)haI743'$$ $ PSC   L@L;83 HBJ7y7snpm"k, JGHQ]tad/}SEED test encryption failed.SEED test decryption failed.1.2.410.200004.1.31.2.410.200004.1.41.2.410.200004.1.51.2.410.200004.1.6SEEDs*GCC: (GNU) 4.2.2 $Ë$.symtab.strtab.shstrtab.rel.text.data.bss.rodata.rel.data.rel.local.comment.text.__i686.get_pc_thunk.cx.text.__i686.get_pc_thunk.bx.note.GNU-stack.group4#<DA+ DX %+++0+ <<l 8 tQHL =U=r"=&=&=t@` BE  @0AKK*TI`!RksCxR*CDTd(      '.@,seed.cSS0SS1SS2SS3KCselftest_failed.5627initialized.5626do_setkeyselftestseed_setkeydo_encryptseed_encryptdo_decryptseed_decryptciphertext.8061key.8060plaintext.8059seed_oids__i686.get_pc_thunk.bx_GLOBAL_OFFSET_TABLE__gcry_log_error_gcry_burn_stack__i686.get_pc_thunk.cxmemcmp_gcry_cipher_spec_seed  $ 3 9 C M U![        ' 7 G  "(#. k y         # 3          ) 9 I         1 ? O _        ( G U e u       . > ] k {      & 4 D T s        < J Z j       # 3 R ` p       ) 9 I h v       1 ? O _ ~        G U e u         ] k {         % s           + ;         # 1 A Q          9 G W g         0 O ] m } { "#    / N \ l |      % 5 E d r       - ; K [ z        C Q a q          Y g w         ! o }          ' 7          - = M         5 C S c       ! ! ,! K! Y! i! y! ! ! ! ! " "" 2" B" a" o" " " " " "  # *# 8# H# X# w# # # # # $ $ !$ @$ N$ ^$ n$ $ $ $ $  % % '% 7% V% d% t% % % % % % & -& =& M& l& z& & & & & & & 5' C' S' c' ' ' ' ' ' ' ' ' J( X( h( x( ( ( ( ( ( ( ) ) ** A*"V*\* j* * * *$* + +$+ @HX\`blowfish.o/ 1249659006 0 0 100644 12660 ` ELF*4(  U E EEEEEEEEEEEE EEE1ЉEEEEEEE1EE‹E1ЉEEE1ЉEEEEEEE1EE‹E1ЉEEE1ЉEEEEEEE1EE‹E1ЉEE E1ЉEEEEEEE1EE‹E1ЉEEE1ЉEEEEEEE1EE‹E1ЉEEE1ЉEEEEEEE1EE‹E1ЉEEE1ЉEEEEEEE1EE‹E1ЉEEE1ЉEEEEEEE1EE‹E1ЉEE E1ЉEEEEEEE1EE‹E1ЉEE$E1ЉEEEEEEE1EE‹E1ЉEE(E1ЉEEEEEEE1EE‹E1ЉEE,E1ЉEEEEEEE1EE‹E1ЉEE0E1ЉEEEEEEE1EE‹E1ЉEE4E1ЉEEEEEEE1EE‹E1ЉEE8E1ЉEEEEEEE1EE‹E1ЉEE<E1ЉEEEEEEE1EE‹E1ЉEE@E1ЉEEDE1ЉEUE UEU E EEEEEEEEEEEE EEDE1ЉEEEEEEE1EE‹E1ЉEE@E1ЉEEEEEEE1EE‹E1ЉEE<E1ЉEEEEEEE1EE‹E1ЉEE8E1ЉEEEEEEE1EE‹E1ЉEE4E1ЉEEEEEEE1EE‹E1ЉEE0E1ЉEEEEEEE1EE‹E1ЉEE,E1ЉEEEEEEE1EE‹E1ЉEE(E1ЉEEEEEEE1EE‹E1ЉEE$E1ЉEEEEEEE1EE‹E1ЉEE E1ЉEEEEEEE1EE‹E1ЉEEE1ЉEEEEEEE1EE‹E1ЉEEE1ЉEEEEEEE1EE‹E1ЉEEE1ЉEEEEEEE1EE‹E1ЉEEE1ЉEEEEEEE1EE‹E1ЉEE E1ЉEEEEEEE1EE‹E1ЉEEE1ЉEEEEEEE1EE‹E1ЉEEE1ЉEEE1ЉEUE UEUEE ‹E ‹E ЉEEE ‹E ‹E ЉEED$ED$E$E‹E U EU EU EU EU EU EU EUS$EEED$E D$E$$@$[]UEE ‹E ‹E ЉEEE ‹E ‹E ЉEED$ED$E$E‹E U EU EU EU EU EU EU EUS$EEED$E D$E$$@$[]USƅƅƅƅƅvƅTƅ2ƅƅAƅyƅnƅƅRƅaƅnƅƅƅƅƅƅ,ƅƅƅCHD$D$$D$D$$GD$cD$$tlx)D$D$$BD$D$$txD$D$$D$D$$yD$D$$tx^D$D$$wD$D$$tx DžxxĔ[]US4u7ǃDtD$$t E2EME􋔃EE}~E\ME􋔃EME􋔃EME􋔃EME􋔃 E E}~EEEEPEE EHEuE EHEuE MEuE MUEE1‹EEuЉEE}XEEEE@ED$ED$E$MUEMUEE}~E8ED$ED$E$MUEMUEE}~E@ED$ED$E$zMUEMUEE}~E@ED$ED$E$(MUEMUEE}~E@ED$ED$E$MUE MUE E}~EEE}UE UE9tZUEUE9tw'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gyabcdefghijklmnopqrstuvwxyz2NBlowfish selftest failed (1).Blowfish selftest failed (2).Blowfish selftest failed (3).Blowfish selftest failed (4).BLOWFISH%s H/GCC: (GNU) 4.2.2$.symtab.strtab.shstrtab.rel.text.data.bss.rodata.rel.data.rel.local.comment.text.__i686.get_pc_thunk.bx.note.GNU-stack.group4 <e 08 %+0 <), 8 T1 L)U)r**, .&  Hg*gg2CCQ b/CpryI     ,blowfish.cks0ks1ks2ks3psdo_encryptdecryptdo_encrypt_blockencrypt_blockdo_decrypt_blockdecrypt_blockselftestbf_setkeyselftest_failed.7151initialized.7150do_bf_setkey__i686.get_pc_thunk.bx_GLOBAL_OFFSET_TABLE__gcry_burn_stackmemcmp_gcry_log_error_gcry_cipher_spec_blowfish 7= h}    V          ! 0 6 @ J RX ~     $* X des.o/ 1249659006 0 0 100644 29192 ` ELFT4(  UVSEE ‹E ‹E ЉEEE ‹E ‹E ЉEE3E%EE1EE1EE3E%EE1EE1EEE ‹E ‹E ‹E ‹E  ‹E ‹E ЉEeE@E @ ‹E@ ‹E@ ‹E@ ‹E @ ‹E@ ‹E@ ЉEeEEȋEEи)ыE %EEȋEEи)ыE %EE$E% ‹E% ‹E% ‹E% ‹E % ‹E% ‹E % ‹E% ‹E % ‹E % ‹E% ‹E% ‹E% ‹E% ‹E% ‹E ‹E  ‹E ‹E ‹E ‹E ‹E E E E% ‹E % ‹E% ‹E% ‹E% ‹E% ‹E % ‹E% ‹E% ‹E% ‹E% ‹E% ‹E% ‹E% ‹E % ‹E% ‹E% ‹E ‹E ‹E ‹E ‹E E E}G[^]US$uAu7ǃ7tD$$t E2uED$E $$ EAM+UEEM+UEEE}~EE$[]U}t E耉EEEEEE E  ‹E  ‹E  ЉEE E  ‹E  ‹E  ЉEE3E%EE1EE1EE3E%EE1EE1EE3E%3333EE1EE1EE3E%EE1EE1EME3E%EE1EE1EME3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EME3E%EE1EE1EME3E%EE1EE1EE3E%3333EE1EE1EE3E%EE1EE1EE3E%EE1EE1EE‹EUEUEUEUEUEUEUEUS$ED$E $E耉D$E$$ EM+UEEM+UEEM >+UEEM!?+UEEM@UEEMAUEEM@UEEMAUEEE} $[]US$uAu7ǃ&tD$$t E2-ED$E $fE耉D$E$LED$E$5$ EM^+UEEM_+UEEM >+UEEM!?+UEEM@+UEEMA+UEEE}5EE$[]U}t EEEEEEE E  ‹E  ‹E  ЉEE E  ‹E  ‹E  ЉEE3E%EE1EE1EE3E%EE1EE1EE3E%3333EE1EE1EE3E%EE1EE1EME3E%EE1EE1EME3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EE3EEEE?1EE?1EE?1EE?1EEE1ЉEEE?1EE?1EE?1EE?1EME3E%EE1EE1EME3E%EE1EE1EE3E%3333EE1EE1EE3E%EE1EE1EE3E%EE1EE1EE‹EUEUEUEUEUEUEUEUS4EMEE ЈD E}~EE?hEU‰EED$D$E$E}u E)}~ EE EEE;E~EE؃4[]UWVSEUEUEUEUEUEUEUEUEEEEEEEEE$EnEʝE˹EEPE8EEE؉D$$!D$ ED$EЉD$$D$ ED$ED$$ED$$D$ ED$ED$$D$ED$E؉$D$ED$EЉ$E}?(D$EȉD$E$tp&EEEEEvETE2EEE4EVExEEEEEE"E3EDEEEEE{E8E;E#EE}E&EEED$ED$$KD$ ED$ED$$%D$ ED$ED$$ED$ ED$ED$$6D$ ED$ED$$E}GD$ED$E$tp D$T$ $EqU荍xU荍HU荵|$ L$D$|$CU荍PD$ ED$T$|$U荍 D$ED$$tpU荍 D$ ED$T$|$,U荍PD$ED$$tpEE D$D$E$tEpE,EUD$D$$E}?~΋ED$$ED$ D$E$EE$}tXpHE/E$unpE}?~DžppĜ[^_]US$EE}t E,E U D$ T$E D$E$EuHE $ u$E $uE $t$@E+$@EE$[]UEEEE tEǀE=EUS$EED$ E D$ED$E$$ $[]US$EED$ E D$ED$E$=$ $[]US$EE}t E,IE D$E$0E $t$@E+$@EE$[]US$EED$ E D$ED$E$$ $[]US$EED$ E D$ED$E$Y$ $[]US$EE}u E1} t$ED$ ED$D$$E E2E$[]UEtED$E $rEE E                                B@@@BB@@@@BBB@BBB@B@@B@BBBB@B@@@ @ @@@ @ @@ @@ @@@ @@ @@@ @@@@ @ @ @@@@ @@@@@ @ @ @@@@ @@ @@ @ @@ @@@ @@@@ @ @@ @@@@@ @@ @@                             @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@8p}׊6e)l|?A%s 1dUZR8IgL&18IgL&18IgL&1QEKX-D qxn*CCCBD0YW7B@#Eg#Eg#Egsomedata=O#EgUUUUUUUU#Egsomedata#EgUUUUUUUUܺvT2somedataHcbrRg fY!dj4Wsquiggle}*f0[~r)tF4 b2[DES maintenance test failed.Triple-DES test failed.Triple-DES SSLeay test failed on encryption.Triple-DES SSLeay test failed on decryption.SHA1 not availableweak key table defectDES weak key detection failedlow-levelcipherDES1.2.840.113549.3.71.3.36.3.1.3.2.11.2.840.113549.1.12.1.33DES@C DWD@BBHCEBGCC: (GNU) 4.2.2 $Ë$.symtab.strtab.shstrtab.rel.text.data.bss.rodata.rel.data.rel.local.comment.text.__i686.get_pc_thunk.cx.text.__i686.get_pc_thunk.bx.note.GNU-stack.group45<0DAE H^P%E +TP 0`P <`S 8 qpLSUTr TTT\W0 L[ %+17@D@@Reo C< V$#w;/ 9BMB8iBK~HCKCy DKWDKDlE3@      '7H _fm{,`,des.csbox1sbox2sbox3sbox4sbox5sbox6sbox7sbox8leftkey_swaprightkey_swapencrypt_rotate_tabweak_keysweak_keys_chksumdes_key_scheduleselftest_failed.5937des_setkeyinitializedselftestdes_ecb_crypttripledes_set2keysselftest_failed.6507tripledes_set3keystripledes_ecb_cryptis_weak_keyC.24.7929do_tripledes_setkeydo_tripledes_set_extra_infodo_tripledes_encryptdo_tripledes_decryptdo_des_setkeydo_des_encryptdo_des_decryptselftest_fipsrun_selftestsoids_tripledes__i686.get_pc_thunk.bx_GLOBAL_OFFSET_TABLE__gcry_fips_mode_gcry_log_error_gcry_burn_stack__i686.get_pc_thunk.cxmemcmpmemcpy_gcry_md_open_gcry_md_write_gcry_md_read_gcry_md_close_gcry_cipher_spec_des_gcry_cipher_spec_tripledes_gcry_cipher_extraspec_tripledes 0 1    . C X m         C X ~  0  12 # 2 8 B L T3Z 45 1W j }       ! 4 G m        $ 7 J ] |        3 F Y l        # I \ o        & 9 X k ~       " 5 H n        % 8 K ^ }        4 G Z m        $ J ] p        ' : Y l        # 6 I o    0 140$ 1)23 = L R \ f n3t 45 1. A T g          D W j }       ! 4 S f y         0 C i |         3 F Y x        / B U h          E X k ~       " 5 T g z        1 D j }       !! 4! G! Z! y! ! ! ! ! ! ! " 0" C" V" i" " " " " " "  #  # F# Y# l# # # # # # # $ #$ 6$ U$ h$ {$ $ $ $ $ $  % % 2% E% k% ~% % % % % % % "& 5& H& [& z& & & & & & & ' 1' D' W' j' ' ' ' ' ' ' ( !( G( Z( m( ( ( ( ( ( ( ) $) 7) V) i) |) ) ) ) ) )  *  * 3* F* l* * * * * * * * #+ 6+ I+ \+ {+ + + + + + , , 2, E, X, k, , , , , , , - "- H- [- n- - - - - - - . %. 8. W. j. }. . . . . . / !/ 4/ G/ m/ / / / / / / / $0 70 J0 ]0 |0 0 0 0 0 0 1 1 31 F1 Y1 l1 1 1 1 1 1 1 2 #2 I2 \2 o2 2 2 2 2 2 3 3 &3 93 X3 k3 ~3 3 3 3 3 3 4 "4 54 H4 n4 4 4 4 4 4 4 4 %5 85 K5 ^5 }5 5 5 5 5 5 6 6 46 G6 Z6 m6 6 6 6 6 6 6 7 $7 J7 ]7 p7 7 7 7 7 7 8 8 '8 :8 Y8 l8 8 8 8 8 8 8 9 #9 69 I9 o9 9 9 9 9 9 9 : &: 9: L: _: ;0; 1; ;6P<0V< 1r=7=7=6= (?62? I? ^?7>@6H@ @6@ A8 A .A HA9eA:vA A6A;A A A  B0B 1B4B4C0 C 1>C4PC0VC 1C4C0C 1C4C4D0D 1MD4_D0eD 1D4D0D 1D D  @HP`h(x|ecc.o/ 1249659006 0 0 100644 25540 ` ELFD4( UEE ]USE ET$$E PE@T$$E PE@T$$[]USE$EE@$E@E@$E@E $E@$E@[]UWVS,E $E؋E$E܋E$EE؃ $E D$E؃ $E$$E}uE,[^_]US$D$D$ ED$D$E$E}tE$D$<$E$[]US$$E$E$E$EE D$ ED$ED$E$E E HT$ ED$L$E$E E @T$ D$ED$E$E D$ ED$ED$E$E$E$E$E$[]US$E$EE$E$tED$`$E D$ED$E$ED$ED$E$E$[]US$} E.U􍋠D$E $tEU􍋠uU􍋠E!ED$E $tEEuыEE5U􍋠ET$$tfEU􍋠uEE!U􍋠D;EtEU􍋠uċU􍋠u E7mt+U􍋠D$u E<9U􍋠TEU􍋠D $‹EU􍋠ȃ$‹EPU􍋠ȃ@$‹EPU􍋠ȃ@$p‹EPU􍋠ȃ@ $D‹EP U􍋠ȃ $‹EP$‹EPEE$[]USTU E D$ EԉD$ED$$E}t EE$EԉD$$E؉D$$E܉D$$ED$$ED$$ED$$ED$$$tE D$$ED$$9EEȉ$E؋UԉD$$EED$ Eԃ D$ED$Eȉ$Eԉ$‹EE؉$‹EPE܉$‹EPE $U Eԃ D$$E$‹EPE$UEȉD$$}E$‹EP(}t;}t5U ED$ T$ED$E$t($}t;} t5UED$ T$E D$E$t($E$Eȉ$E$Eԉ$E @D$E$EET[]UWVSE $EԋE $E؋E $E܋E $EE $E$tX$E$xE|$$}xE$ED$E$D$E D$Eԉ$ED$ ED$ED$Eԉ$@tf$ED$ ED$ED$Eԉ$t$$t$E$E$]E$E$E$E܉$E؉$Eԉ$e[^_]US4$EUE@ T$$[EEEHE@T$ L$D$E$ED$E$t*$t$EE@D$$u*$t$EE$EPET$$EU EHED$ T$L$E$ED$$t@$t4$E$E$EE@$D$$u5$td$E$EU EH(ED$ T$L$E$UE@9uLEUR 9u?EUR$9u2$t$E$EE$E$EE؃4[]USDEE$E$E$E$EEԉ$D$E$D$E$E PE T$$EUE$E @D$$OEU ED$ T$ED$Eԉ$ED$ EԉD$D$E$t*$t$EE @D$ED$E$D$E$3E PE H(T$ ED$L$E$E @D$ ED$ED$E$E @D$ED$E$E @D$ ED$ED$E$D$E$BE$Eԉ$E$E$E$E$E$ED[]USTED$E$~E @D$E$x EMD$E$~E @D$E$x E$E$E$E$E$EEԉ$Eȉ$E$E PE T$$EE @D$ED$E$E @D$ ED$ED$E$U ED$ T$ED$Eȉ$E @D$ ED$ED$E$U ED$ T$ED$E$ED$ ED$EȉD$Eԉ$ED$$u*$t$EED$ EԉD$ED$E$t*$t$EE @D$ED$E$ED$E$t{$tbED$B$ED$G$ED$L$ED$Q$V$E$tp$E$E$Eȉ$Eԉ$E$E$E$E$E$EEET[]UVS@E$EE$EEEEUED$ED$ T$ED$$E}tE$D$$UE9vJMUE)ƉUL$ED$$UE)ȉD$D$E$EEUE D$ED$ T$ED$$E}tE$D$$UE9vJMUE)ƉUL$ED$$UE)ȉD$D$E$ED$D$ ED$D$E$E}tE$D$$E$E$E $E@[^]USDE $EE$EUE D$ED$ T$ED$$E}tE$EEnEuE$EAPE<tE$EE/EtE$EA EEEUD$D$ T$D$E$E}tE$EEMUED$L$ D$D$E$EE$}tE$EE\UET$$UE@T$$E@D$$E$E$EE؃D[]UVSpE}tYD$D$E$E}t3D$E$EE$}u EAo} u}u EDW$E$E$E$EED$ED$ED$ED$ ED$E D$E$E܋E$}t E܉EUEUEUEu ED$ED$E$UEȉuED$ED$E$rUE؉E $E$D$$‹EEu EEEp[^]U(D$ED$ED$D$ D$E D$E$UVSPED$ EȉD$ED$$#E}t EE$E$EE̋UȉD$$EED$ Eȃ D$ED$E$t$E$Eȃ $UȋE U ẺU EЉu EȉD$ED$E$U EE EEăP[^]USDE txE tlE t`E tTE tHE t:?K S@lAB/ . C  . =CO ] w  C    1D> i     0 \ 8/ .?  E &E3 ;EH PE] eEr zE E? @4F G3*3=3S4v343H 7$ H. 6 7A IL 2W 1 / . 9 9 9 9 9 ?  @ 4R 4 A  7  7 ?  @ 2* 25 1@ 1K 1V 1a 1u /{ . J ; K ?  @ L0 ?: B @Y 4p F G L ?  @ 2 I L ? ( @3 Ie G ?  @ I I 2 / .JJ.J=JK4^MqMF1GH? @BBUL;<N;L I2!1,171B1M1b/h .LKLKJJJ J/J=4H4S4jFN;G;G5OHLX?b j@H? @BK? E( 0E= EER ZE` h@}? @I22211111/ .=8PrQ6 7RSQ.68 @7qRS56 7T1 1/% .0=DPoQTTTT(5<Ty5T100M11/ .3 BU^VlW9999T22XYD/J .99FH 7I2s/y .24c2422222)2F/L .4 204a2o2JJ112"2>/D .4 21 4b 2p 2 2 2 / . =!/! .A! [!U!Z!W! !U "VB"T"1"["\"Y# !# 8#]C#^Y#_r#_# #_#T#`#/# .# *$   $(,048<@DHLPTX\`dhlptx|  $(,0<@DHLPT`dhlptx $(,8<@DHL $$(,048@DPTX\`dhelgamal.o/ 1249659006 0 0 100644 10872 ` ELF4(  UEE ]USt2D$D$ ED$D$ $҃[]UE"E;ErEE EEuЋEEEUSD$EE $EE $EE $EEEE܋E@EE@ED$E D$E$E܉D$ ED$ED$E$w ED$ ED$ED$E$ ED$E$tMED$ ED$ED$E$\ E܉D$ ED$ED$E$~ uME$E$E$E$}t^}uXEt E E̋Et E EЋẺD$EЉD$$$}th$tXEt E EԋEt E E؋EԉD$E؉D$$$ED[]US4$E܋E@$EE$EE$EE} t@E$‰EE;Er&GD$D$M$EEEE$tW$D$ED$E$}t}w#E$D$E$E$.-E$$t $ E$E$E܃4[]USDE $E܋E $EEtE$EED$ED$ ED$E D$$ED$E؉D$E܉$UEE;E r lD$D$$M$E$E$tED$x$E$t $.z}tm}w)E$ED$$EZD$$ED$ED$E$E$ED$$EED$ D$ED$E$ED$E$D$E$E܉D$E$E$E $EE؉D$ ED$ED$E$$t`$ %E؉D$$ED$$ED$$ED$$UE؉UEBUEBUEB E܉$E @D$D$E$7D[]USDEE@E@E@ E$E}?vE;E r E7bE $EE $ZEEtE$EED$ED$ ED$E D$$ED$ED$E$$tED$$D$E$~ED$E$x-E$E$E$E7eE $EED$ ED$ED$E$$t`$ ED$$ED$$ED$$ED$$UEUEBUEBE$‹EP E$E @D$D$E$tgE$EE@$E@E@$E@E@ $E@ EEE؃D[]US$E@@$EEEH E@T$ L$D$E$E@D$E$EE$E$[]US$ED$$EEEHT$ ED$L$E$EEHT$ ED$L$E $ED$ ED$E D$E $E$$[]US$E@$EEE@ T$ D$E D$E$ED$ED$E$ED$ ED$ED$E$E$$[]US$E@$EE@$EE$ED$ED$E$ED$$`EEEHT$ ED$L$E$EP ED$T$E$ED$ ED$ED$E$ED$ED$E$ED$ ED$ED$E $E$E$E$E$$[]USDD$E$~ED$E$x EE@$EE@$EEE@T$D$E$EEEEЋE@EEEԋEEE EEEED$ EЉD$ED$E$D$E$EE$E$EEȋEȃD[]US4E}t^D$D$E$E}t8D$D$E$EE$}u Ez}t%ED$ ED$E D$E$gE ED$E D$E$3EUEUEUEU EEE؋E؃4[]U(ED$E D$E$UEUEUEU EU(EE t$E tE t E u E?E EE EE EE EE$uEEUVS E}t!EtEt Eu EpEEEEEEE@$‹E u E@$E E ED$ ED$T$ $E [^]UVS0EEt9Et-Et$EtEt E u EgEEEEEEE EE@$‹E EE0E ED$ L$t$$E0[^]UVS0E}t-Et$EtEt E u E{EEEEEEE EE@$‹E u E@$E E ED$ ED$T$ $VE0[^]U(EEt3Et'} t!EtEt Eu EPEEEEEEEEED$ E D$T$ $uEEUSE $[]w    (19@HOpk_elgsign+verifyencrypt+decryptElgamal test key for %s %s failed gen_kelgamal.cchoosing a random k generatechoosing a random x of size %uelg p= elg g= elg y= elg x= using a supplied x of size %uxvalueelgopenpgp-elgopenpgp-elg-sigELGpgypgyxabrs n2GCC: (GNU) 4.2.2 $Ë$.symtab.strtab.shstrtab.rel.text.data.bss.rodata.rel.data.rel.local.comment.text.__i686.get_pc_thunk.cx.text.__i686.get_pc_thunk.bx.note.GNU-stack.group4'<)D #`% +0<l 8 )L,U>rBFF& t ("T18v]C/M X `/ Beq'lG~l n On2  %.    8"W n )9H\fw7FXgv <\elgamal.cprogress_cbprogress_cb_dataprogresst.5847wiener_maptest_keysdo_encryptdecryptsignverify__FUNCTION__.5930gen_k__FUNCTION__.5994generategenerate_using_xcheck_secret_keyelg_generate_extelg_generateelg_check_secret_keyelg_encryptelg_decryptelg_signelg_verifyelg_get_nbitselg_names_gcry_register_pk_elg_progress__i686.get_pc_thunk.cx_GLOBAL_OFFSET_TABLE___i686.get_pc_thunk.bx_gcry_mpi_new_gcry_mpi_randomize_gcry_mpi_cmp_gcry_mpi_release_gcry_log_fatal_gcry_get_debug_flag_gcry_log_debug_gcry_mpi_alloc_secure_gcry_mpi_alloc_gcry_mpi_copy_gcry_mpi_get_nbits_gcry_bug_gcry_mpi_sub_ui_gcry_free_gcry_random_bytes_securememcpy_gcry_mpi_set_buffer_gcry_mpi_cmp_ui_gcry_mpi_gcd_gcry_mpi_add_ui_gcry_mpi_free_gcry_generate_elg_prime_gcry_mpi_snew_gcry_mpi_clear_highbit_gcry_mpi_powm_gcry_log_mpidump_gcry_mpi_mulm_gcry_mpi_invm_gcry_mpi_mul_gcry_mpi_subm_gcry_mpi_mulpowm_gcry_sexp_find_token_gcry_sexp_nth_mpi_gcry_sexp_release_gcry_pubkey_spec_elg_gcry_pubkey_extraspec_elg' (  *)0 (6 @ F c }' (   ) (** **U+,- --#-? J ] h  ./     0 ) (1-2;3I4  5/ 067 8&8C9N7o:,/;/<=)/M7Y/t>>) (*2?64 F N5Y@h/y 0/788 9708Z:oA;,7*B/ C #C0 8CE MC{-) (4 *5 2` ?} 6 /  0 ; , - - - ** B6 /S [ Ch p C}  C  C 3 - - -/ -G -v )| ( 2 B , > ) (; B` B D > ) ( 1 B E D% >7 )= (K 2\ 2l 3 6 B FGE;DF>Q>\>g>y) (;,22EQHd;z>>) ( IJKw)} (22;)A (1) (22) (4 $(,048@DHLPTX`pubkey.o/ 1249659006 0 0 100644 35076 ` ELFS4( USD$D$ D$D$v0$E[]USD$D$ 9D$D$0$E[]USD$D$ PD$D$0$E[]USD$D$ ^D$D$0$E[]USD$D$ lD$D$0$E[]USD$D$ wD$D$0$E[]USD$D$ D$D$0$[]UVS0EEE@ uEB E@$uEOB$E@(uEB(E@,uEB,E@0uE<B0E@4uEB4E@8uEB8ELE4EDD$L$ t$D$$EE}uEI}t D$D$0$0[^]US$EEE EE@EED$E$EEED$E$E}t Euփ}$[]US$3D$ED$$EE$[]US4Et$<E$} tE E EED$ED$ ED$D$$E$}uUEEPEEEE4[]UED$$U} tEE MEEUS$E$$[]USE$EEEu݃[]US$E}u E$uvǃ$$E$E}tE@EE$$EEE$[]US$$uǃ$$ED$$E}tE@EE$ E$E$[]US$E$u*ǃ$$ED$$E}tPE@EE@t E@EEEE}t EuEEE$$E$[]US$$ED$$E}t)E@uE@ƒEPE$$$[]US$E$uǃ$$ED$$E}tcE@EE 4u E@tE tE@u E)E@tEE$E$E$[]US$E$uǃ$$ED$$E}tE@@$EE$$E$[]US$E$u#ǃ$$ED$$E}tE@@ $EE$$E$[]US$E$usǃ$$ED$$E}tE@@$EE$$E$[]US$E$uǃ$$ED$$E}tE@@$EE$$E$[]US4E$uǃ$$ED$$E}E@ E}tGE@t=EPE D$ED$ED$ED$ ED$E D$E$҉E0E@P ED$ED$ ED$E D$E$҉EE$$E4[]US$E$uǃ$$ED$$E}t&E@P$E D$E$҉EE$$E$[]US$$tnueED$$E"EED$$EE$;E΋ED$$$ED$$E}tCE@EEP(ED$ED$ ED$E D$E$҉EE$E$}uT$tDu;E"EE D$$EE$ ;E΋E$[]US$E $ED$$E"EED$$EE$;EE"EED$$EE$:;E΍$ED$$E}tCE@EEP,ED$ED$ ED$E D$E$҉EE$E$}u0$t uE D$$E$[]US$$tnueED$$E"EED$$EE$;E΋ED$$$ED$$E}tD$E$EME‹dEEE‹dulD$E$ED$D$E$UE܉);Er<D$ D$0D$$EDŽE}vEȉ$ƋEĉ$EED$$E}u$EE#EMEЉEE;E|Ջ`tEU`PdtFdt:0EME‹d‹E)ƉEE;ErȋED$ E܉D$D$E$EE$}t D$D$0$E܉$E$`$h$dtd$d$E$E$E$}t'$E$$E$ 0[^]US4EEE$uGǃ$ED$ ED$D$E$5E}Au$ED$ ED$D$E$ E}t EgE@EEH8UE@T$$щE$E$$E$E$EE؋E؃4[]UStEEEEEE$u ǃ$D$D$E$Eԃ}u D$vD$E$Eԃ}u D$&D$E$Eԃ}u D$<D$E$Eԃ}u EEԉ$E؋Eԉ$E؉EED$Eԉ$E}$E$rE$}E@E܋E@ EE܋@E}D$D$EЉ$}t,E@t"EHUЋEԉD$$хq EEED$ED$Eԉ$E؃}3ẺD$D$E؉$E} ŰET$D$ QD$D$E$E$UЉD$ED$$E̋UЉD$ED$$E؉$UD$D$$EEE } u$E } tHED$$D$D$E $EЉ$Eԉ$E E3E$E؉$EЉ$Eԉ$EEt[]USE$u{ǃ$E t$} t}t E-E $E=E$[]US4EE Eԃ}_EE\}t EEEE؉E}t E-$ED$E$ EE$ueǃ$$ED$$E}tE@@EE$$UEgE$EUEOE$vEUE7E$EUEE$EUEE=E܉$4[]USE$uDǃ$E[]US$E$uǃ$$ED$$E}t U EE$E$[]US$E$$[]US$E$E D$ED$$E$E$[]US4EEE$u衶ǃ$$ED$$E}tE@u E@ E$}t)Et EED$E D$E$҉EqE}td}t E@t"}t E EEE EED$ WD$ED$$EЃ}t'$E$$E$4[]US4$u,ǃ$EEEED$$E}u E?E@E} t+E@$E}u$ET}t+E@$E}u$E#} tU E}tUEEE$}tE$E$E4[]-dummy_generateusing dummy public key functionpubkey.cdummy_check_secret_keydummy_encryptdummy_decryptdummy_signdummy_verifydummy_get_nbitspk_register_default?pubkey_encrypt: algo=%d pkey: data: encr:pubkey_decrypt: algo=%d skey: plain:pubkey_sign: algo=%d sig:pubkey_verify: algo=%d hash:RSAnedpqusexp_elements_extract_eccidx >= 6curveprivate-keypublic-keyecdsaeccsig-valflagsenc-valrawpkcs1no-blindingsha1md5sha256ripemd160rmd160sha384sha512sha224md2md4tigerhavalsexp_data_to_mpidatahashvaluei > 0n == nframei > 1_gcry_pk_encryptmodule(enc-val(%m)))_gcry_pk_decrypt(value %m)%m_gcry_pk_sign(sig-val(_gcry_pk_genkeygenkeyrsa-use-enbits(key-data(public-key((private-key(%S(misc-key-info(pm1-factors)p - string < neededprotected-private-keyshadowed-private-key(1:%c%u:algorithm disabledalgorithm not foundno selftest availablepubkey   -GCC: (GNU) 4.2.2$.symtab.strtab.shstrtab.rel.text.data.bss.rel.data.rel.rel.rodata.rel.data.rel.local.comment.text.__i686.get_pc_thunk.bx.note.GNU-stack.group4P<N i%PN+PN4`N` 0 |PBN > ̇NRh J ` ^HSgZS^S^SV H |`h  `/AOP9bOOyPO^Ol <Ow OO)) =P3zi=}.1={%     *0 : &Jbwq4p.gMzPs|? h  !! 2FD/O/]oo KHI7IOIgIIH 5Ph &;R?f{n 5H[bm-GN]j|{+#B)/R %2+6;7L8 \dCyxG HIWJ J? J]' 9 DKK LDa pubkey.cpubkey_tablepubkeys_registered_lock__FUNCTION__.5914dummy_generate__FUNCTION__.5921dummy_check_secret_key__FUNCTION__.5931dummy_encrypt__FUNCTION__.5941dummy_decrypt__FUNCTION__.5950dummy_sign__FUNCTION__.5963dummy_verify__FUNCTION__.5970dummy_get_nbits__FUNCTION__.5981pk_register_defaultpubkeys_registeredgcry_pk_lookup_func_namegcry_pk_lookup_namegpg_errordummy_extra_specgpg_err_makerelease_mpi_arraydefault_pubkeys_registereddisable_pubkey_algocheck_pubkey_algopubkey_get_npkeypubkey_get_nskeypubkey_get_nsigpubkey_get_nencpubkey_generatepubkey_check_secret_keypubkey_encryptpubkey_decryptpubkey_signpubkey_verifysexp_elements_extract__FUNCTION__.6673sexp_elements_extract_eccsexp_to_keysexp_to_sigsexp_to_enchashnames.7016__FUNCTION__.7001sexp_data_to_mpi__FUNCTION__.7341gcry_errorgcry_err_make__FUNCTION__.7463__FUNCTION__.7541__FUNCTION__.7753.L763.L762.L764.L765.L766.L767.L768_gcry_pubkey_spec_rsa_gcry_pubkey_extraspec_rsa_gcry_pubkey_spec_elg_gcry_pubkey_extraspec_elg_gcry_pubkey_spec_dsa_gcry_pubkey_extraspec_dsa_gcry_pubkey_spec_ecdsa_gcry_pubkey_extraspec_ecdsa__i686.get_pc_thunk.bx_GLOBAL_OFFSET_TABLE__gcry_fips_signal_error_gcry_module_add_gcry_bugstrcasecmp_gcry_module_lookup_gcry_pk_register_gcry_fips_mode_gcry_ath_mutex_lock_gcry_ath_mutex_unlock_gcry_pk_unregister_gcry_module_release_gcry_mpi_free_gcry_pk_map_name_gcry_pk_algo_name_gcry_module_lookup_id_gcry_pk_aliased_algo_namestrlen_gcry_get_debug_flag_gcry_log_debug_gcry_log_mpidump_gcry_sexp_find_token_gcry_sexp_nth_mpi_gcry_sexp_releasestrcmp_gcry_free_gcry_assert_failed_gcry_sexp_nth_string_gcry_sexp_cadr_gcry_calloc__errno_locationgpg_err_code_from_errno_gcry_sexp_nth_gcry_sexp_length_gcry_sexp_nth_datamemcmp_gcry_malloc_secure_gcry_random_bytes_securememcpy_gcry_mpi_scan_gcry_malloc_gcry_md_map_name_gcry_md_get_algo_dlen_gcry_md_algo_infomemset_gcry_pk_encrypt_gcry_pk_get_nbitsstpcpymalloc_gcry_sexp_build_arrayfree_gcry_pk_decrypt_gcry_sexp_build_gcry_pk_sign_gcry_pk_verify_gcry_pk_testkey_gcry_pk_genkeystrtoul_gcry_pk_get_keygrip_gcry_md_opensnprintf_gcry_md_write_gcry_md_read_gcry_md_close_gcry_pk_ctl_gcry_pk_algo_info_gcry_pk_init_gcry_pk_module_lookup_gcry_pk_module_release_gcry_pk_list_gcry_module_list_gcry_pk_selftest_gcry_pk_get_elementsstrdupP Q & 8 @RWP] Qc u  RP Q   RP Q  % -RDPJ QP b t |RP Q   RP Q   R2P8 QT j v            " . : P \ h ~      S    (T;PA QjUUP Q  VP QX" *Y> d lSu }ZP Q Y\ 'Z9P? QN]vP| Q Y   Z Y\  Z&P, Q2 :Y@ O Y aZg oYx `\  ZP Q Y    Z !Y* 6`\ ZP Q Y ` \  Z- P3 Q@ H YN ] g o Zu } Y  ` \  Z( P. Q; C YI X b j Zp x Y  ` b \  Z P Q  Y    Z ( Y1 = `W be \k s Z P Q  Y    Z  Y  ` b \ # Z8 P> QK S YY h r z Z  Y  ` b \  Z P Q  Y  " * Z0 8 YA M ` \  ZP Q! )Y/ > H PZV ^Yg s`\ ZP QcX d  eA IeO WY` l`\ ZcX  e<PB QWcdXy d e e Y `d\s {ZcX eP QcX d !eB JeP XYa m`\ ZcX  e6P< QHcUXj rd e e e  Y  `q\ ZP Qfg&h i i`jP Q   kf_glh flhRj]h0jXP^ Qq | fmhlh Y" *Z0 ?iI Xi}jhbnopfhwj} Y\ ZP Q fq1hPldhoh ijhqhl Y Z(j@hKhtbnophh Y\ ZjGPM Q fql .iJrns t t t. hA qa jt l h  Y  Z b !n!o"!pV!ha!hl!jx! !Y!\! !Z!j!P! Q"" 1"fU"g" "f"r"s# #t:# I#tl# {#t#h# #f# #f$g$s?%uM%oW%p% % % %k%v=&v&j&w&j'w' .' 8' @'kh'xs'j'r's( 3(b,( 3?(tQ( 3_( 3m( 3(y(w(z(j({)sN)|)y)o)p * * '* /*kL*}*w*w* * * *k+x'+j;+hF+hQ+h+P+ Q+ +Y+ + + +Z', 9, C, K,k,,b,n-o-pP-]l-bz-b-y-o-p- -w-$. 3.U. d.ws..o.p...  / /T /j=/jY/jf/ n/Yy/\/ /Z/P/ Q0 $0Y*0 90 C0 K0Z!1 ,1 P1Z1 l1 t1T1j1]1j1 1Y1\2\2 2Z.2P42 Qf2 n2Yt2 2 2 2Z2 2 2 2kM33b3n3o3p3b4b,4y@4oJ4pX4 g4|44 44 4w45o5pg5u55 5 5T5j5j5]5j6P6 Q?6 G6YM6 \6 f6 n6Z6j7j7j7]7 7Y7\7\7 7Z8P 8 Q8 '8Y-8 <8 F8 N8Z8j8P8 QN9 V9Y\9 k9 u9 }9Z9 9f9m9h9l: :Y1: 9:ZD:j:b: : :T; ;f:;ss;w;;h; ;f;s7<w`<n<h<h=b =bg=b= = =T=y=o=p= == =>B> Q>> >> >>> >.? =?^? m?? ?? ?@ @0@ ?@wV@ h@ r@ z@k@b@b@n@o@pAAjA A ATAjAjBh7BjBBhMBhXBhdB lBYwB\}B BZBPB QB BYB B B BZ}C CYC\C CZCjCPC QD  DYD "D ,D 4DZBD QDfhD wDfD DfD DfDmDhEl$E ,EY@E HEZEEfFsFF ]FhFb~FFFhF FFyGGw%G0GhCGjNGhYGdGhGPG QG GYG G G GZHPH QCH H HYH H H HZH HYH H`I\!I )IZIPI QI IYI I I IZJPJ Q!J )JY/J >J HJ PJZVJ ^JYgJ sJ`J JZJPJ QJ JYJ\J JZJPJ QK  KYK &K/K 7KZLKPRK QmK uKY{K K K KZK KYK K`K KZGL RL cL sL L L LYL\L LZLPL QL LYL L  M MZ/M ;M`mM{MoMpMMoMpM\MNHIJK J$K0L4M@NDO\ ?` @d @h @l @p @t @x A| B C D @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ E (08@HPXmd4.o/ 1249659006 0 0 100644 5112 ` ELF4(  UEEE#EgE@E@ܺE@ vT2E@E@TUSdEEE@EE@EE@ ED$@E D$E$E3E#E3EMED$$ EE3E#E3EMED$$EE3E#E3EMEčD$ $EE3E#E3EMEȍD$$EE3E#E3EME̍D$$hEE3E#E3EMEЍD$$=EE3E#E3EMEԍD$ $EE3E#E3EME؍D$$EE3E#E3EME܍D$$EE3E#E3EMED$$EE3E#E3EMED$ $fEE3E#E3EMED$$;EE3E#E3EMED$$EE3E#E3EMED$$EE3E#E3EMED$ $EE3E#E3EMED$$EE EU!‹E#E ЋMEyZD$$XEE EU!‹E#E ЋME̍yZD$$!EE EU!‹E#E ЋME܍yZD$ $EE EU!‹E#E ЋMEyZD$ $EE EU!‹E#E ЋMEyZD$$|EE EU!‹E#E ЋMEЍyZD$$EEE EU!‹E#E ЋMEyZD$ $EE EU!‹E#E ЋMEyZD$ $EE EU!‹E#E ЋMEčyZD$$EE EU!‹E#E ЋMEԍyZD$$iEE EU!‹E#E ЋMEyZD$ $2EE EU!‹E#E ЋMEyZD$ $EE EU!‹E#E ЋMEȍyZD$$EE EU!‹E#E ЋME؍yZD$$EE EU!‹E#E ЋMEyZD$ $VEE EU!‹E#E ЋMEyZD$ $EE3E3EMEnD$$EE3E3EME܍nD$ $EE3E3EME̍nD$ $EE3E3EMEnD$$kEE3E3EMEčnD$$>EE3E3EMEnD$ $EE3E3EMEԍnD$ $EE3E3EMEnD$$EE3E3EMEnD$$EE3E3EMEnD$ $]EE3E3EMEЍnD$ $0EE3E3EMEnD$$EE3E3EMEȍnD$$EE3E3EMEnD$ $EE3E3EME؍nD$ $|EE3E3EMEnD$$OEEMEE@MEPE@MEPE@ MEP d[]UEM EE]US$E EEEE@T@u:ED$E$$$hE@TE@PEP}E@TtX$EHTEETQEPTEm}t E@T?~D$D$E$7}t~$h3ED$E$sE@TE@PEPm@E@}?w$EHTEETQEPTEm}t E@T?~˃$[]US4EED$D$E$zE@EEEEEEEE@TEE;EsEEEeeE EE@T7=EPTEDEPTEPTEDEPTE@T7~tEPTEDEPTEPTEDEPTE@T?~D$D$E$ED$8D$$E‹EPLE‹EPME‹EPNE‹EPOE‹EPPE‹EPQE‹EPRE‹EPSED$E$T$hEEUEEUE@EUE@EUE@ E4[]UEEE0 0 *H 1.2.840.113549.2.4MD4 : K XGCC: (GNU) 4.2.2$.symtab.strtab.shstrtab.rel.text.data.bss.rodata.rel.data.rel.local.comment.text.__i686.get_pc_thunk.bx.note.GNU-stack.group4 <_  `X % + 0 < H 8 @ L(U:r>>  II   S(: 2K ;?   L cy (md4.cmd4_inittransformrolmd4_writemd4_finalmd4_readasnoid_spec_md4__i686.get_pc_thunk.bx_GLOBAL_OFFSET_TABLE_memcpy_gcry_burn_stackmemset_gcry_digest_spec_md4QW   -  B H r    $, 48<@whirlpool.o/ 1249659006 0 0 100644 34208 ` ELFw4(  US$EED$D$E$$[]UWVSlEE쉅EE Ɖ׉U E¸ Ƌ ׋U E¸ щU E¸ Ƌ ׋U E щU E Ƌ ׋U E щU E DTE}E#MUEЋRhlE}vE#MUEЋR(,E}vEMME싴(,EtŨ|Ŭ11(,E}vE,hlƉ׉1%`dEUƉ׉1%d`1Ƌ1׋EU1d`11щEUƉ׉1%d`1Ƌ1׋EUd ` 11щEUƉ%d(`(1Ƌ1׋x|d0`011щpt%d8`81Ƌ1׋E苔11ptƉ׉1%`dhlƉ׉1%d`1Ƌ1׋EU1  d`11щEUƉ׉1%d`1Ƌ1׋EUd ` 1 1щ$ $ $EUƉ%d(`( 1lj($1щ,(,(,EUƉ%d0`0(1Ƌ,1׋x|0404`8d88<81<1x|Ɖ׉1%`d@DptƉ׉1%d`@1ƋD1׋hl1HLHLd`1P1щTPTPTEUƉ׉1%d`P1ƋT1׋EUX\X\d ` 1`1щd`d`dEUƉ%d(`(`1ljhd1щlhlhlEUƉ%d0`0h1Ƌl1׋EUptpt`8d8x|x1|1EUƉ׉1%`dx|Ɖ׉1%d`1Ƌ1׋pt1d`11щhlƉ׉1%d`1Ƌ1׋EUd ` 11щEUƉ%d(`(1lj1щEUƉ%d0`01Ƌ1׋EU`8d811EUƉ׉1%`dEUƉ׉1%d`1Ƌ1׋x|1d`11щptƉ׉1%d`1Ƌ1׋hld ` 11щEUƉ%d(`(1lj1щEUƉ%d0`01Ƌ1׋EU`8d811 EUƉ׉1%`dEUƉ׉1%d`1Ƌ1׋EU1  d`11щx|Ɖ׉1%d`1Ƌ1׋ptd ` 1 1щ$ $ $hlƉ%d(`( 1lj($1щ,(,(,EUƉ%d0`0(1Ƌ,1׋EU0404`8d88<81<1EUƉ׉1%`d@DEUƉ׉1%d`@1ƋD1׋EU1HLHLd`1P1щTPTPTEUƉ׉1%d`P1ƋT1׋x|X\X\d ` 1`1щd`d`dptƉ%d(`(`1ljhd1щlhlhlhlƉ%d0`0h1Ƌl1׋EUptpt`8d8x|x1|1EUƉ׉1%`dEUƉ׉1%d`1Ƌ1׋EU1d`11щEUƉ׉1%d`1Ƌ1׋EUd ` 11щx|Ɖ%d(`(1lj1щptƉ%d0`01Ƌ1׋hl`8d811 $E&ME싔hlE}vԋ(,Ɖ׉1%`d`dƉ׉1%d`1Ƌ1׋X\1d`11щPTƉ׉1%d`1Ƌ1׋HLd ` 11щ@DƉ%d(`(1Ƌ1׋8<d0`011щ04%d8`81Ƌ1׋hl1104Ɖ׉1%`d(,Ɖ׉1%d`1Ƌ1׋`d1  d`11щX\Ɖ׉1%d`1Ƌ1׋PTd ` 1 1щ$ $ $HLƉ%d(`( 1Ƌ$1׋@D(,(,d0`0101щ404048<%d8`801Ƌ41׋pt8<81<18<Ɖ׉1%`d@D04Ɖ׉1%d`@1ƋD1׋(,1HLHLd`1P1щTPTPT`dƉ׉1%d`P1ƋT1׋X\X\X\d ` 1`1щd`d`dPTƉ%d(`(`1Ƌd1׋HLhlhld0`01p1щtptpt@D%d8`8p1Ƌt1׋x|x|x1|1@DƉ׉1%`d8<Ɖ׉1%d`1Ƌ1׋041d`11щ(,Ɖ׉1%d`1Ƌ1׋`dd ` 11щX\Ɖ%d(`(1Ƌ1׋PTd0`011щHL%d8`81Ƌ1׋EU11HLƉ׉1%`d@DƉ׉1%d`1Ƌ1׋8<1d`11щ04Ɖ׉1%d`1Ƌ1׋(,d ` 11щ`dƉ%d(`(1Ƌ1׋X\d0`011щPT%d8`81Ƌ1׋EU11 PTƉ׉1%`dHLƉ׉1%d`1Ƌ1׋@D1  d`11щ8<Ɖ׉1%d`1Ƌ1׋04d ` 1 1щ$ $ $(,Ɖ%d(`( 1Ƌ$1׋`d(,(,d0`0101щ40404X\%d8`801Ƌ41׋EU8<81<1X\Ɖ׉1%`d@DPTƉ׉1%d`@1ƋD1׋HL1HLHLd`1P1щTPTPT@DƉ׉1%d`P1ƋT1׋8<X\X\d ` 1`1щd`d`d04Ɖ%d(`(`1Ƌd1׋(,hlhld0`01p1щtptpt`d%d8`8p1Ƌt1׋EUx|x1|1`dƉ׉1%`dX\Ɖ׉1%d`1Ƌ1׋PT1d`11щHLƉ׉1%d`1Ƌ1׋@Dd ` 11щ8<Ɖ%d(`(1Ƌ1׋04d0`011щ(,%d8`81Ƌ1׋EU11 $E&ME싔(,E}vԃE}  EQU쉕UE4Ћ|EtŨ|Ŭ11MTE}vEWE쉅UE4Ћ|E싴(,11MTE}vl[^_]US4E EEEUE@u"E@D$E$Eǀ}E*EEET@QEEm}tE?vD$D$E$4}A'ED$E$bEǀm@E@}?w*EEET@QEEm}tE?vEEU҉EUEjE Eu}t` +UEЋE%E +ME‹EEUEUmE} vE Eu}t*`@D$ D$Hn@D$z@$4[]U(EEED$E D$E$US$EED$D$E$E􋐀ED@E􉐀E􋀀 vgE􋐀ED@E􉐀E􋀀?vD$D$E$E􋐀ED@E􉐀E􋀀vՋMU@E􋀀D$ L$$E􋀀P E􉐀D$D$E$E3E UEЋR1‹ET@EHUEЋR1‹ET@EHUEЋR1‹ET@EHUEЋR1҉‹ET@EHUEЋR‹ET@EHUEЋR‹ET@EHUEЋR‹ET@EHUEЋR‹ET@E}$[]UEEE@O#RoyҦ65{ `WK.J7wk )Xg>]ؕ}A'Gf|3Z-0x`&F###~?oL&mbڸ  nBO!OOl666QY oyyy0_ooom?~RURRG'```5evʼ7+ͬV[ql<` 0 {{{j555:itGS!{ל^/C\m...)zbK1KK]!ծWAWW*ATwwwn777V{#ٌF# jJ5JJDOڢ%X}XXϏ|RU)))Z"P ( PO]ikkk\.>>- (xgggSsN%'''sX2AAA ,SQ}}}I7ܕnVGp0q#|||qfff{Sݯ.K\EFGGG!܄BԉXZu---.cyƿ?8G#/ZuZZl6f333\?ccc I89⨯qqqƍ2}d;prI9II_C1HK㹶*[q[[ 4>)ȤR L-&&&d222Y}Jjw3x<3st:'a|¾&͉h4442uzH=HHT$zzzd=z>_a__=@ ghhh4rhA,}u^ɴ괴ΨTMTT;v/D """cddd*梿sss$ZHz]:@@@H(@ V+{3MK_az===[3̗f6nVE+++쳗vvvd2(6wltw[C)wjjj P]PPWLE EE8`000t+~???ǪUIUUYyejeeeihҺJ^e///N'`_8lpF.dRM)MMv9r꼏uuu6 0 $Ky@򲲅Yc~6p8>c|U7bbb:wԁM2)R1Ėbb:f3J5%%% YyYYT*䧷rrrr999aZL-LL;^e^^xxxp888 cW AMCN/aaaB{E4B!!!%֔JΙ"UD kJN%NNfsQѷ混` x<<<|>@5Ԕj og޹&_LQX},,,kӌ\k9Wnnnn7 ܬVEVV^ID DDO7!gTM*** kmֻF#SQSSrWS'X , 'ӜN+Glllb111蹇ttt LC FFFE& <(DPB[,NXt:::oiiiA-H $ ୧pppoqTٶⶶg~;.hW*BBB,-´ZUIuP](((1\m\\k?D"0x`F###&~?ƸoL&mbڸ nBO!OO l666QYo yyy_ooo0?~mRURR'```Gevʼ5+ͬV7[q<` 0 l{{{j555:itGSೳ{!^/œ\m...CzbK1KK)!]WAWW*ATwwwn777V{#ٌF#jJ5JJ OD%X}XXRU)))|"P ( ZOP]ikkk\.gsν<4]i]] P@ |>>> (-gggxSsN%'''X2AAAs ,SQ}}}7ܕnIGV0pq#|||fffqS{.K\FGGGE!܄BZu---Xcyƿ.8?G#/ZuZZl6f333?ccc\ I89⨯qqqލ2}dђprI9II;C_1HK㨶*[q[[ 4)ȤR>L-&&& d222}JYj3x<ws3t:a|¾'&h444uzH=HH2$Tzzz=zd>_a__@ =ghhh4rhA,u^ɴ괴}TMTT;vD """/dddc*梿sss$ZH]:@@@z(@ HV+Õ{3߫KM_az===3̗f[6VE+++n쳗vvvd2汩(6wlw[tC)wjjj P]PPLE EEW8`000t+~???ڪUIUUYyeeeejihҺ^e///JN'_`8lp.FdRM)MM9rv꼏uuu 06 $y@KYc6p8~>c|7bbbUw:M2)1ĖbR:bf3ţJ5%%% YyYYT*䧷rrrr999aZL-LL;^e^^xxxp888 cW AMC/aaaN{EBB!!!4%֔J"UD kJN%NNsQѷ混f` x<<<|>5Ԕj@ og޹&_LX},,,Qk\kWnnn9n7Ī VEVV܈ID DD^O7!TM***gkmֻ F#SQSS񥋮Wr'X , S'ӜNGlll+b111蹇ttt C FFFLE& <(DPB[,NXt:::oiii-H $ A୧pppqTٶⶶog~;օ.W*BBBh-´Z,UIP](((u1\m\\?kD"x`0###&F~?Ƹo͡L&bڸm nBO!OO 666lYQo yyy_ooo0~m?RURR'```Gvʼ5eͬV7+q[<` 0 l{{{555jit:GSݬ{!^/œm...C\zbK1KK)!]WAWWծAT*www777nV{ٌF##jJ5JJ OD%X}XXϏU)))|R"P ( ZOPi]kkk֫\.sν>>|(- gggxSsջ%'''NX2AAAs, QS}}}ܕnI7GV0pq#|||fffq̎S{K\.FGGGE܄B!ԉu---XZyƿ.c8?#G/ZuZZl6333f?ccc\ 89Iqqqƍ}d2prI9II;C_1HK*[q[[4 ȤR>)-&&& L222dJY}j3x<ws3t:|¾'a&444huzH=HH2$Tzzzzd=>_a__ =@ghhhrh4,A^ɴ괴}uTMTTΨv; """/Ddddc*sssZH$]:@@@z(@ HV+Õ{3ŐKMa_===z̗f[36E+++nVvvvd2(wl6[tw)Cwjjj P]PPLE EEW8000`t+???~UIUUǪyYeeeejhҺie///J^N'_`lp8.FdRM)MMrv9uuu06 $ @KyYc6p8~c|>7bbbUģw:2)MĖbR1:bf3ţ5%%%J YyYYT*rrr999raZL-LL;^e^^xxx888p c AWMC/aaaNEB{!!!4B֔J%fxUD" kJN%NNQѷ混fs` <<Ԕj@5 g޹o_L&},,,QXk\kWnnn9n7Ī VEVVܬID DD^7!OM***gTmֻ kF#SQSS񦋮Wr'X , SӜN'Glll+111bttt C FFFL& E<DP(B[NX,:::toiii-H $ ApppTٶⶶoqg~;.W*BBBh´Z,-IU](((uP1\m\\?kD"`0x###&F~?ƸoL&ڸmb BO!OO n666lYQo yyy_ooo0~m?RURR'```Gʼ5evV7+q[` 0 l<{{{555jt:iSG{!^/œm...C\bK1KK)z]!WAWWծT*Awww777n{VF##jJ5JJ ODX}XX%ϏU)))|RP ( Z"POi]kkk\.ν>>|(- gggxsS%'''N2AAAsX, QS}}}ܕnI7GVp0#q|||fffqS{\.KGGGEFB!ԉu---XZƿ.cy8?G#ZuZZ/l6333f?ccc\ 9I8qqqƍd2}rI9II;pC_1KH[q[[*4 R>)-&&& L222dY}Jjx<w3s3t:¾'a|&޽444hzH=HH2uT$zzzzd=_a__> =@ghhhh4rA,ɴ괴}u^TMTTΨv; """/Ddddc*sss梐H$Z:@@@z]@ H(V+Õ3{KMa_===z̗f[36E+++nVvvvd2(l6wtw[C)wjjjߺP]PP E EEWL8000`+t???~ÒUIUUǪyYeeeej칺Һihe///J^N'_`p8lF.RM)MMdrv9uuu06 $ Ky@cYp8~6|>c7bbbUw:)M2ĖbR1b:f3ţ5%%%JYyYY T*rrr999rZL-LLa^e^^;xxx888p cAW CM/aaaNB{E!!!4BJ%xшD"U JN%NNkѷ混fsQ `<<Ԕj@5 ޹ogL&_},,,QXkk\Wnnn9n7Ī VEVVܬD DD^I!O7M***gTֻ kmF#SQSSWrX , S'N'Glll+111bttt FFFLC E&<P(D[BX,N:::toiiiH $ A-pppٶⶶoqTg;~.*BBBhWZ,-IU](((uP\m\\1k?D"`0x###&F?Ƹ~o&Lڸmb O!OO nB666lQYo yyyooo0_~m?RURR```G'ʼ5evV7+ͬ[q 0 l<`{{{555jt:iGS{!/œ^...C\mK1KK)zb]!WAWWծT*Awww777nV{F#ٌ#J5JJ jODX}XX%Ϗ)))|RU ( Z"PPOᠺ]ikkk.\ν>>|- (gggxSs'''N%AAAsX2 ,SQ}}}ϕnI7GVp0q#|||fffqS{\.KGGGEFB!܄ԉ---XZuƿ.cy?8G#ZuZZ/6l333fccc\? I89qqq⨯ƍd2}I9II;prC_1HK[q[[* 4R>)Ȥ&&& L-222dY}Jj<w3xs3:t¾'a|&444hH=HH2uzT$zzzzd=_a__> =@hhhgh4rЮA,괴}u^TMTTΨv;"""/D dddc*sss梿H$Z@@@z]: H(@+ÕV{3KM_a===zf[36+++nVEvvv쳗2d(l6wصtw[C)jjjwP]PP E EEWL8000`t+???~UIUUǪYyeeeejҺih///J^e'N_`p8lF.M)MMdRrv9uuu꼏6 0 $Ky@Yc8~6p|>cbbbU7w:M2)bR1b:3ţf%%%J5YyYY *Trrr䧷999rL-LLaZ^e^^;xxx888p݌ cƥW AMCaaaN/B{E!!!4BJ%֔xD"U N%NNkJ混fsQ` <<|j@5 ޹ogL&_,,,QX}k\knnn9W7Īn VEVVܬD DD^IߩO7!***gTMֻ km#FSQSSWr , S'XN'Ӝlll+G111bttt蹇 FFFLC E& <P(DB[X,N:::tiiio $ A-Hppp୧ⶶoqTg~;.BBBhW*Z,-´UI(((uP]\m\\1k?"D`0x##&F#?Ƹ~Ƈo&Lڸmb !OO nBO66l6QYo yyyoo0_o~m?URRR``G'`ʼ5evV7+ͬ[q0 l<` {{{55j5t:iGS{!/œ^¸..C\m.1KK)zbK]!AWWծWT*Awww77n7V{F#ٌ#5JJ jJOD}XX%XϏɤ))|RU)( Z"P POᱺ]ikkk.\ν>|>- (ggxgSs''N%'AAsX2A ,SQ}}}nI7ܕGVp0q#|||ffqfS{\.KGGEFGB!܄ԉʴ--XZu-ƿ.cy?8G#uZZ/Z6l33f3cc\?c I89qq⨯qƍd2}9II;prIC_1HKq[[*[ 4R>)Ȥ&& L-&22d2Y}J鰃j<w3xs3:t¾'a|&44h4=HH2uzHT$zzzzd=a__>_ =@ hhghh4rA,괴}u^ɴMTTΨTv;쓈""/D "ddcd*ss梿sH$Z@@z]:@ H(@+ÕV×{3KM۾_a==z=f[3̗6Ϭ++nVE+vv쳗v2d(l6wtw[C)jjwj]PP P EEWLE800`0t+??~?IUUǪUYyeeejeҺih//J^e/'N_`p8lF.)MMdRMrv9uu꼏u6 0 $Ky@Yc8~6p|>cbbU7bw:ԚM2)bR1Ėb:3ţfŔ%%J5%yYY Y*Trr䧷r99r9-LLaZLe^^;^xxx88p8 cѮW AMCaaN/aB{E!!4B!J%֔xD"U %NNkJN混fsQѷ` <|j@5Ԕ ޹ogL&_,,QX},kӻ\knn9Wn7Īn EVVܬV DD^IDO7!**gTM*ֻ km#FQSSSWr, S'X N'Ӝll+Gl11b1tt蹇t FFLC FE& >|>- (ggxgSs''N%'AAsX2A ,SQ}}}镕I7ܕnVGp0q#|||ffqf{S.K\GGEFG!܄Bԉ--XZu-.cy?8G#ZZ/Zul633f3cc\?c I89qq⨯qƍ2}dII;prI9_C1HK[[*[q 4>)ȤR&& L-&22d2ȰY}Jjw3x<3st:'a|&44h4HH2uzH=T$zzzd=z__>_a =@ hhgh4rhA,}u^ɴTTΨTM;v""/D "ddcd*ss梿s$ZH@@z]:@H(@ ÕV+{3MK_a==z=[3̗f6++nVE+vv쳗vłd2(6wltw[C)jjwjPP P]EEWLE 800`0t+??~?UUǪUIYyeeejeih//J^e/N'`_8lpF.MMdRM)v9ruu꼏u6 0 $Ky@Yc~6p8>c|bbU7b:wM2)R1Ėbb:ţf3%%J5%YY YyT*rr䧷r99r9LLaZL-^^;^exxx88p8 cW AMCaaN/aB{E!!4B!%֔J"UD NNkJN%fsQѷ` <@5Ԕj og&_L,,QX},k\knn9WnĪn7 VVܬVEDD^ID ᩩO7!**gTM* kmF#SSSQrW S'X ,'ӜNll+Gl11b1tt蹇t FFLC FE& <(DPB[,NX::t:iioi A-H $pp୧pݶoqTٶg~;.BBhW*B,-´ZUI((uP](\\1\mk?džD"0x`#&F##Ƹ~?oL&mbڸ O nBO!O6l66QY oyyyo0_oom?~RRUR`G'``5evʼ7+ͬV[q l<` 0 {{{5j55:itGS!{œ^/.C\m..K)zbK1K]!WծWAW*ATwww7n77V{#ٌF#J jJ5JDOX%X}XϏ)|RU)) Z"P ( PO]ikkk\.|>>- (gxggSs'N%''AsX2AA ,SQ}}}I7ܕnVGp0q#|||fqff{S.K\GEFGG!܄Bԉ-XZu--.cyƿ?8G#Z/ZuZl63f33c\?cc I89q⨯qqƍ2}dI;prI9I_C1HK[*[q[ 4>)ȤR& L-&&2d22Y}Jjw3x<3sՀt:'a|¾&4h44H2uzH=HT$zzzd=z_>_a_ =@ hghh4rhA,}u^ɴTΨTMT;v"/D ""dcdd*s梿ss$ZH@z]:@@H(@ ÕV+{3MKۡ_a=z==[3̗f6+nVE++v쳗vvd2(6wltw[C)jwjjP P]PEWLE E80`00t+?~??UǪUIUYyeejeeihҺ/J^e//N'`_8lpF.MdRM)Mv9ru꼏uu6 0 $Ky@Yc~6p8>c|bU7bb:wԨM2)R1Ėbb:ţf3%J5%%Y YyYT*r䧷rr9r99LaZL-L^;^e^xxx8p88 cѥW AMCaN/aaB{E!4B!!%֔J"UD NkJN%NfsQѷ` @5Ԕj og޹&_L,QX},,k\kn9WnnĪn7 VܬVEVD^ID DO7!*gTM** kmֻF#SSQSrW S'X , 'ӜNl+Gll1b11t蹇tt FLC FFE& <(DPB[,NX:t::ioii A-H $ p୧ppoqTٶg~;.BhW*BB,-´ZUI(uP]((\1\m\k?D"whirlpool_addwhirlpool.c! (buffer_size || carry)WHIRLPOOL@@ 3135GCC: (GNU) 4.2.2$.symtab.strtab.shstrtab.rel.text.data.bss.rodata.rel.data.rel.local.comment.text.__i686.get_pc_thunk.bx.note.GNU-stack.group4 <5 | %6+60 6@ <v( 8 x( LvUvrvvy { P````` `("`0%`8(9790K`@]0k 3'{135    (whirlpool.crcC0C1C2C3C4C5C6C7whirlpool_initwhirlpool_transform__FUNCTION__.6417whirlpool_addwhirlpool_writewhirlpool_finalwhirlpool_read__i686.get_pc_thunk.bx_GLOBAL_OFFSET_TABLE_memset_gcry_assert_failedmemcpy_gcry_digest_spec_whirlpool /FL K R     5 <     P W      # Y `      k r   ! ( g n     b i     l s     ^ e     Z a     o v      9 @     ] d     S Z     < C     X _     J Q     4 ;     [ b     % ,     7 >     ? F      o v   . 5     B I     Y `     u |   , 3     C J     _ f   ! ! ! ! ! ! -" 4" " " " " I# P# # # $ $ o$ v$ $ $ % % k% r% % % -& 4& & & & & S' Z' ' ' ' ' O( V( ( ( ) ) v) }) ) ) 7* >* t* {* * * 3+ :+ + + + + Z, a, , , - "- X- _- - - . . |. . . . >/ E/ / / 00 2 2 2 393?3 /4 rfc2268.o/ 1249659006 0 0 100644 5724 ` ELF4(  UVEEfEfEfEfEE‹E fEE‹E fEE‹E fEE‹E fEE‹E fEE‹E fEE‹E fEE‹E fEEuEEEE!ЉEf#E EPfEEEf fEEE!ЉEf#E VEPfEEEf fEEE!ЉEf#E VEPfEEEf fEEE!ЉEf#E VEPfEEEf fE}t} uPEƒ?EPfEEƒ?EPfEEƒ?EPfEEƒ?EPfEE}E‹E U EfU EU EfU EU EfU EU Ef^]UVEEfEfEfEfEE‹E fEE‹E fEE‹E fEE‹E fEE‹E fEE‹E fEE‹E fEE‹E fEEtEEEfE fEEE!ЉEf#E VEPf)EEfE fEEE!ЉEf#E VEPf)EEfE fEEE!ЉEf#E VEPf)EEfE fEEE!ЉEf#E EPf)E}t} uPEƒ?EPf)EEƒ?EPf)EEƒ?EPf)EEƒ?EPf)Em}E‹E U EfU EU EfU EU EfU EU Ef^]UVS0EEEEu7ǃtD$$t E2}w E,pEEEEUEE EE;ErEEAEuUE)EȋUE%E}vEE}EE+EEEEЋE؉!EEUE+EEE2EEEUEm}uE7uEEȋUE ȉ‹EfpE}?vEEԃ0[^]UD$ ED$E D$E$USD$ D$D$|$D$lD$|$D$D$l$t(hD$ D$D$|$lD$lD$|$D$D$l$tLhD$ D$(D$|$D$lD$|$D$ D$l$tphD$ D$(D$|$lD$lD$|$D$D$l$thD$ D$D$|$D$lD$|$D$D$l$thD$ D$D$|$lD$lD$|$D$D$l$th DžhhĤ[]3k^0Pbu1 xݵ(yJ؝~7+vSbLdDYOaEm }2@놷{ !"\kNTe`sVu;B=0<&oFiW'C>/fހRr5Mj*qZItK^AnQ$Pp9|:#z6[%U1-]㊒)glឨ,c?X≩ 843H _.G奜w hRFC2268 selftest failed (%s). (RFC2268 encryption test 1 failed.RFC2268 decryption test 1 failed.RFC2268 encryption test 2 failed.RFC2268 decryption test 2 failed.RFC2268 encryption test 3 failed.RFC2268 decryption test 3 failed.1.2.840.113549.1.12.1.6RFC2268_40(GCC: (GNU) 4.2.2$.symtab.strtab.shstrtab.rel.text.data.bss.rodata.rel.data.rel.local.comment.text.__i686.get_pc_thunk.bx.note.GNU-stack.group4 <F  X % 8+ (0 ! <L 8 ,0 LLU^rbbD  dn #.CT`!%i)s (     $:JQ ,rfc2268.crfc2268_sboxdo_encryptdo_decryptselftest_failed.5957initialized.5956setkey_coreselftestdo_setkeyciphertext_3.6076plaintext_3.6075key_3.6074ciphertext_2.6073plaintext_2.6072key_2.6071ciphertext_1.6070plaintext_1.6069key_1.6068oids_rfc2268_40__i686.get_pc_thunk.bx_GLOBAL_OFFSET_TABLE__gcry_log_errormemcmp_gcry_cipher_spec_rfc2268_40  ! 0 6 @ J RX   U  ,2 H `        % F ^        # D \        !  (8<@arcfour.o/ 1249659006 0 0 100644 3108 ` ELF4(  U EEE@EEEEeEEEeEEȋEU‹EEEU‰ȈEEEЋEE%E0‹E E Em}iEUEUPUS$EEED$ ED$E D$E$$@$[]US$EEu7ǃtD$$tDž28}wDž,#E@EPEEME‹ETE}~E!MEuE  E}~EEEvUEDUE‰1)1‰)ȉEUEDEMUETETME‹ETE}~D$D$$Dž$[]US$EEED$E D$E$E$,E$[]US4D$D$$D$ D$D$$RD$D$$t$D$D$$D$ D$D$$D$D$$tH Dž4[]L,acARCFOUR selftest failed (%s) 8)Arcfour encryption test 1 failed.Arcfour decryption test 1 failed.ARCFOURjGCC: (GNU) 4.2.2$.symtab.strtab.shstrtab.rel.text.data.bss.rodata.rel.data.rel.local.comment.text.__i686.get_pc_thunk.bx.note.GNU-stack.group4 <G $ % +0r< , 8  LLU^rbbD   J,ARd)mI|    ,arcfour.cdo_encrypt_streamencrypt_streamselftest_failed.5679initialized.5678do_arcfour_setkeyselftestarcfour_setkeyciphertext_1.5750plaintext_1.5749key_1.5748__i686.get_pc_thunk.bx_GLOBAL_OFFSET_TABLE__gcry_burn_stack_gcry_log_errormemsetmemcmp_gcry_cipher_spec_arcfour $* 6 @ O U _ i qw  )/ = ]     "  $(rijndael.o/ 1249659006 0 0 100644 30824 ` ELFtb4(  UVSpEuAu7ǃ tD$x2$t E2E@E@}uBE Et`E@UED$E D$$8}uE E"} uEE E,UE܉E@E.EMEE 0Uȃ<EE;ErʋEE!UEMEm}yEEEVE E‹EMEEEE;E}}~}u EEE;EE܃;EUED0ЈEUED0ЈEUED0ЈEUED0ЈEUE20ЈEE}tLE6UE UE0EPE1EE;E|E6UE UE0EPE1EU;EULUD0ȈDULUD0ȈDULUD0ȈDULUD0ȈDUE6UE UE0EPE1EE;E|EVE E‹EMEEEE;E}}~}u EEE;E} E܃;E΋E܃;EEEp[^]US$EEED$E D$E$E$E$[]UVSEUEU EUEHU EUEHU EUEH U E E}JEYUEEEE"0E&1ƋE*1ƋE.1UEEEE"0E&1ƋE*1ƋE.1UEEEE"0E&1ƋE*1ƋE.1UE EEE"0E&1ƋE*1ƋE.1EE;E[^]UVS EEMEE 1ЉEHEE 1ЉEHEE 1ЉEH E E 1ЉM E0E1E 1E 1E E0E1E 1E 1E E0E1E 1E 1E E0E1E 1E 1ENuE U E1ȉEpE U E1ȉEpE U E1ȉEp E U E 1ȉM E0E1E 1E 1E E0E1E 1E 1E E0E1E 1E 1E E0E1E 1E 1EE;EuE E PE1ȉEpE E PE1ȉEpE E PE1ȉEp E E PE 1ȉEE U EU EU EU EU EU EU EU EU EU EU EU EU EU EU Eu E U E1ȉE ƋE U E1ȉE ƋE U E1ȉE ƋE U E 1ȉ [^]US4D$ED$E$ED$E܉D$E$mD$E܉D$E $4[]UWVSLEEEEE} t EED$ED$E؉$Eu؍}ȍUȓD$EȉD$E$L[^_]US$EEE@t/ED$ E D$D$E$"$?%ED$E D$E$$8$[]US4EEEEEEE@bE D$ E D$D$E$E EE(U E0ȈEEEEE}~҃m}u`E D$E D$E$E EE(U E0ȈEEEEE}~҃m}u$84[]US4EEEEEEE EE#EMEEE0ЈEE}~׋E@t#ED$ ED$D$E$MED$ED$E$D$ED$E $E}uEm}L$84[]UVS EEuEUE1ȉEpEUE1ȉEpEUE1ȉEp E UE 1ȉM E0E1E1E1E E0E1E1E1E E0E1E1E1E E0E1E1E1EEZuE UE1ȉEpE UE1ȉEpE UE1ȉEp E UE 1ȉM E0E1E1E1E E0E1E1E1E E0E1E1E1E E0E1E1E1m}ME E1ЉEHE E1ЉEHE E1ЉEH E E1ЉE!E U E!U E!U E!U E!U E!U E!U E!U E!U E!U E!U E!U E!U E!U E!U E!M E E1ЉE E E1ЉE E E1ЉE E E 1Љ [^]US4E@u!E${$@E@D$ED$E$ED$E܉D$E$JD$E܉D$E $4[]US$EEE@t/ED$ E D$D$E$$8%ED$E D$E$$8$[]US4EEEEEEE@lE D$ E D$D$E$CE EE2EEEE2UEEUEEE}~ȃm}ujE D$E D$E$$E EE2EEEE2UEEUEEE}~ȃm}u$84[]USDEEEEEED$ED$E؉$E@t#ED$ ED$D$E$ED$ED$E$GE EE#EMEEE0ЈEE}~D$E؉D$E $EEm}8$XD[]US4D$2D$$2D$D$$D$|2D$$t2^D$D$$D$2D$$t2 Dž4[]US4D$D$$D$D$$D$2D$$t2^D$D$$D$D$$t3 Dž4[]US4D$ @D$$`D$D$$D$<3D$$tL3^D$D$$D$`D$$tl3 Dž4[]UE}uE}uE}tEEEEEUVS3HD$T$ $DžDžE)UU-T;Et EEvσ}u-$$5UU-TD$ D$D$$E}t-$$#55UU-TD$ D$D$$E}t-$$#5UD$D$$E}u=UD$D$$E}t-$$(5 UD$D$$E}u@UD$D$$E}t-$$05QEUE􍵤D$D$ D$D$$E}t-$$75UE􍵤0D$D$$t-$$G5<UE􍵤0D$D$ D$D$$E}t-$$X5UE􍵤D$D$$t*$$h56EE$$DžĐ[^]US$y5EFE}uK}t<5E$GE}u'5E$)E}u E1} t$ED$ ED$D$5$E E2E$[]US$y5EE}u E1} t$ED$ ED$D$5$E E2E$[]US$y5EE}u E1} t$ED$ ED$D$ 5$E E2E$[]U(EE}t%} t6}tEED$E $HE5ED$E $EED$E $4EE E  vwtuwpqr !"#$&'()+,-.jEߕ!c|w{ko0g+׫vʂ}YGԢr&6?4q1#'u ,nZR;ֳ)/S [j˾9JLXCM3EPfHa5WiَU(ߌ BhA-Tcc||ww{{ kkooT`00PggV++}bMvvE@}}YYGG Ag_E#Srr[u=L&&jl66Z~??AOh44\Q4qqsb11S*? RF##e^0(7 / $6=&N''iuu X,,t4.6-nnZZ[RRv;;Ma}R)){>^//qSSh,@ `yȶ[[jjFgr99KJJޘLL԰X